Gene Information

Name : Alide2_2166 (Alide2_2166)
Accession : YP_004388053.1
Strain : Alicycliphilus denitrificans K601
Genome accession: NC_015422
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 2266135 - 2266530 bp
Length : 396 bp
Strand : +
Note : TIGRFAM: Hg(II)-responsive transcriptional regulator; PFAM: Transcription regulator MerR, DNA binding; HTH transcriptional regulator, MerR; KEGG: rme:Rmet_5990 mercury resistance regulatory protein MerR; SMART: HTH transcriptional regulator, MerR

DNA sequence :
GTGAGCGCGCTGACGATAGGGGGTCTGGCTGACGAGGCTGGCGTAAACGTCGAGACCATCCGCTACTACCAGCGGCGCGG
GCTGATGCCGGAGCCGGACAAGCCGGCTCACGGGTATCGCCGCTACGACGCCACCACGGTCAAGCGCGTGCGCTTCATCA
AGCGGGCACAGGCACTCGGCTTCACGCTGGAAGAGATCGGCGGCTTGCTCGAACTCGACGAGGCCCATGCCTGTGCCGAA
ACGCGCGAACTGGCCTCGCACAAGCTGGAGGCTATCGAAACCAAGCTGGCCGACTTGGCGGCGATGCGCAGGGCGCTCAT
GACTCTGCTGCGCCAGTGCGATGCGGGCGCGATGAAGGGTAACTGCCCCATCATCCACGCCCTGGGTGCGGACTGA

Protein sequence :
MSALTIGGLADEAGVNVETIRYYQRRGLMPEPDKPAHGYRRYDATTVKRVRFIKRAQALGFTLEEIGGLLELDEAHACAE
TRELASHKLEAIETKLADLAAMRRALMTLLRQCDAGAMKGNCPIIHALGAD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 8e-23 60
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 7e-18 53
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-17 53
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 4e-19 52
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 3e-16 50
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-17 50
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-17 50
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-17 50
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 3e-17 50
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-17 50
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-17 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide2_2166 YP_004388053.1 MerR family transcriptional regulator BAC0684 Protein 3e-19 53
Alide2_2166 YP_004388053.1 MerR family transcriptional regulator BAC0688 Protein 1e-18 52
Alide2_2166 YP_004388053.1 MerR family transcriptional regulator BAC0689 Protein 1e-17 52
Alide2_2166 YP_004388053.1 MerR family transcriptional regulator BAC0686 Protein 1e-19 51
Alide2_2166 YP_004388053.1 MerR family transcriptional regulator BAC0687 Protein 1e-17 51
Alide2_2166 YP_004388053.1 MerR family transcriptional regulator BAC0683 Protein 2e-18 51
Alide2_2166 YP_004388053.1 MerR family transcriptional regulator BAC0232 Protein 1e-17 51