Gene Information

Name : Alide2_2186 (Alide2_2186)
Accession : YP_004388073.1
Strain : Alicycliphilus denitrificans K601
Genome accession: NC_015422
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2282643 - 2283326 bp
Length : 684 bp
Strand : -
Note : TIGRFAM: Signal transduction response regulator, heavy metal response; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; KEGG: ajs:Ajs_2725 two component heavy metal response transcriptional

DNA sequence :
GTGAAGATATTGATCGTCGAAGACGAGCCCAAGACTGGCGAATATTTGCGCCAAGGCTTGAGCGAGGCCGGGTATGTCGC
GGACCTGGTGCCCCATGGCACCGATGGGCTGCACATGGCCTTGCACGGTGCCTACGACCTCGTGATCCTGGATGTCATGC
TGCCCGGGCTGAACGGCTGGCAGGTGCTGCAATCGCTGCGCGAGCGCGGCCTGCAAATGCCCGTGCTGTTCCTGACCGCC
CGCGACCAGGTCGAAGACCGCGTCAAGGGGCTGGAGCTTGGCGCCGACGACTATTTGGTCAAGCCGTTCTCGTTTGCGGA
ACTGCTGGCCCGCGTGCGCATCATCTTGCGCCGCGCGCCTGCCGGCAACGAGGCCATGGTGTTGCGCGTGGCCGACCTGG
AACTGGACCTGCTGCGCCGCCGGGTCTCGCGCAATGGCCGGCGCGTGGACCTGACGGCCAAGGAGTTCGGCCTGCTGGAA
CTGCTGATGCGTCGCCACGGCGAGGTCTTGCCACGTTCCCTGATCGCATCGCAAGTGTGGGACATGAATTTCGACAGCGA
CACCAACGTCATCGAAGTGGCGATGCGACGACTGCGCATGAAGATCGACGAGGGCCACCCGATCAAGCTCATCCAGACCG
TGCGCGGCATGGGTTATGTGCTCGACGTACCGCAGGAGGAATAG

Protein sequence :
MKILIVEDEPKTGEYLRQGLSEAGYVADLVPHGTDGLHMALHGAYDLVILDVMLPGLNGWQVLQSLRERGLQMPVLFLTA
RDQVEDRVKGLELGADDYLVKPFSFAELLARVRIILRRAPAGNEAMVLRVADLELDLLRRRVSRNGRRVDLTAKEFGLLE
LLMRRHGEVLPRSLIASQVWDMNFDSDTNVIEVAMRRLRMKIDEGHPIKLIQTVRGMGYVLDVPQEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-50 59
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-49 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator BAC0197 Protein 4e-61 68
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator BAC0638 Protein 3e-55 67
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator BAC0083 Protein 3e-61 66
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator BAC0111 Protein 5e-57 63
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator BAC0125 Protein 3e-59 63
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator BAC0308 Protein 5e-57 61
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator BAC0347 Protein 3e-51 60
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator NC_007793.3914065.p0 Protein 4e-27 42
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator NC_002758.1121390.p0 Protein 4e-27 42
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator NC_010079.5776364.p0 Protein 4e-27 42
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator NC_002952.2859858.p0 Protein 4e-27 42
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator NC_007622.3794948.p0 Protein 4e-27 42
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator NC_003923.1003417.p0 Protein 4e-27 42
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator NC_013450.8614146.p0 Protein 4e-27 42
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator NC_002951.3238224.p0 Protein 4e-27 42
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator HE999704.1.gene1528. Protein 2e-26 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator VFG0596 Protein 2e-50 59
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator VFG1390 Protein 7e-34 43
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator VFG1386 Protein 2e-29 43
Alide2_2186 YP_004388073.1 two component heavy metal response transcriptional regulator VFG1389 Protein 3e-26 42