Gene Information

Name : Lbuc_1782 (Lbuc_1782)
Accession : YP_004399093.1
Strain : Lactobacillus buchneri NRRL B-30929
Genome accession: NC_015428
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1831681 - 1832376 bp
Length : 696 bp
Strand : +
Note : KEGG: lbr:LVIS_0317 DNA-binding response regulator; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal transduction resp

DNA sequence :
ATGACGAATACCATCCTGCTGGTTGAAGACGAGGAAGCACTCAGCTCGTATTTAATCCCAGAATTAAAATTTGAAGATTA
TCAGGTATTGTTGGCAAAAGACGGTCTTGAAGCCCTCCAAGTCTATGACAATAACCGAGGCAACTTAGATCTGATCATTC
TGGATTGGATGCTGCCAAAGCTTGACGGACTGGAAGTTCTACGGCGAATCCGCAAAAATGATGACATCCCAGTCATCATG
ATGACCGCCAGAGATTACGTCGGCGATAAAGTCGCTGGACTCGACAGCGGTGCCGATGATTACATTACCAAACCATTTGA
AATCGAAGAACTGCTGGCCCGAATTCGAGTCGTTCTCCGCCACGAGAGTCATCACCACCAGCAAAGCGAACTGTATACCG
TAGAGGACCTGACCTTAAACACCAAGTCCCGCCAGGTTTCGCGGGGAAATCAACTGATTCAACTCACCCAACGGGAGTAC
GAATTGTTATTAACCCTCATTCGCCACGGCGGCGAAACCCTCACCCGTGATGAGCTGCTTGACGCAGTTTGGGGGGTCGA
CTTCGAAGGCCAGCCAAATGTCGTTGACGTTTATATCCGCTACTTGCGCAACAAAGTTGATCGGGGATATTCCAAACAGC
TGATCCACACGGTCCGTGGAGTCGGCTATGTGATGTCCGGAAATTATCAGGAATAA

Protein sequence :
MTNTILLVEDEEALSSYLIPELKFEDYQVLLAKDGLEALQVYDNNRGNLDLIILDWMLPKLDGLEVLRRIRKNDDIPVIM
MTARDYVGDKVAGLDSGADDYITKPFEIEELLARIRVVLRHESHHHQQSELYTVEDLTLNTKSRQVSRGNQLIQLTQREY
ELLLTLIRHGGETLTRDELLDAVWGVDFEGQPNVVDVYIRYLRNKVDRGYSKQLIHTVRGVGYVMSGNYQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-37 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 6e-41 49
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-41 47
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-41 47
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-41 47
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-41 47
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-41 47
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-41 47
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-41 47
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-41 47
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-36 45
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-40 44
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-38 44
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-40 43
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-32 41
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-34 41
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-45 47
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-38 43
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-37 42
Lbuc_1782 YP_004399093.1 winged helix family two component transcriptional regulator VFG1386 Protein 5e-39 42