Gene Information

Name : VAB18032_20120 (VAB18032_20120)
Accession : YP_004405726.1
Strain : Verrucosispora maris AB-18-032
Genome accession: NC_015434
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3464198 - 3464977 bp
Length : 780 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
GTGACCGGTAGTGGCGACGGGTGTCCGGCGTTCGGGCACCCGCCGCCGACCGTCACGGCGAGCGACGACCGGGGTGCGCG
GGACTACCCTGGGTACGTCATGGACGGCCGCGTGCTGGTGGTCGAGGACGACGCCTCCATCAGGGAGGTCACCGCCCTCG
GGCTGCGCCGCGCCGGGTTCCGGGTGGACACCGCCGCCGACGGTCGACAGGGTCTGGCCGCCTGGCGCGCCGGGTCGGTC
GATCTGATCGTGTTGGACGTGCTGCTGCCGGGCTTGGACGGTCTGCAGGTGTGCCGGGAGATCAGGCGCAGCAACGCGGT
GCCGATCCTCATGCTCACCGCCCGCACCGACACCATCGACGTGGTGGTCGGGCTGGAGTGCGGCGCCGACGACTACCTGC
GTAAACCCTTCGACCTGCCCGAACTGGTGGCCCGGGTACGGTCGCTGCTGCGCCGCGCCGTCGCAGCACCCGAGCCGGGC
CCGCTGCGGATCGGTCGCCTGGAGATCGACCCTGGCGCTTTCGTGGCCCGCCGGGACGGTCACGAGCTGCCGCTGACCGC
CACCGAGTTCCGGCTGCTGCTGGAGCTGGCCCGCCGCCCGGGGCAGGTCTTCACCCGCGAGCTGCTGCTGGAACGGGTCT
GGGAGCAGGGCTACCTCGGCGACAGCCGGCTGGTCGACGTGGCGGTGCAGCGGCTGCGGGCCAAGGTCGAGGACGATCCG
GCCAGTCCACGCCTGATCCGCACCGTACGTGGTGCCGGCTACAAGCTGACCGCGAGCTGA

Protein sequence :
MTGSGDGCPAFGHPPPTVTASDDRGARDYPGYVMDGRVLVVEDDASIREVTALGLRRAGFRVDTAADGRQGLAAWRAGSV
DLIVLDVLLPGLDGLQVCREIRRSNAVPILMLTARTDTIDVVVGLECGADDYLRKPFDLPELVARVRSLLRRAVAAPEPG
PLRIGRLEIDPGAFVARRDGHELPLTATEFRLLLELARRPGQVFTRELLLERVWEQGYLGDSRLVDVAVQRLRAKVEDDP
ASPRLIRTVRGAGYKLTAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-20 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-19 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-39 54
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-36 49
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-30 47
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 8e-31 47
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-31 47
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 8e-31 47
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 8e-31 47
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 8e-31 47
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 8e-31 47
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-30 47
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 8e-31 47
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 8e-31 47
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-22 46
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator BAC0308 Protein 8e-20 46
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator BAC0083 Protein 3e-22 45
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-16 45
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 7e-30 44
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator BAC0111 Protein 1e-20 42
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 3e-21 42
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 3e-21 42
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 5e-21 42
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator BAC0039 Protein 3e-21 42
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-21 41
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator BAC0347 Protein 2e-19 41
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator BAC0596 Protein 6e-20 41
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 6e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-20 46
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-19 45
VAB18032_20120 YP_004405726.1 winged helix family two component transcriptional regulator VFG1390 Protein 9e-23 43