Gene Information

Name : Selsp_2063 (Selsp_2063)
Accession : YP_004414469.1
Strain : Selenomonas sputigena ATCC 35185
Genome accession: NC_015437
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2292288 - 2293052 bp
Length : 765 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: aar:Acear_1915 two component transcriptional regulator, winged helix family; PFAM: Signal transduction r

DNA sequence :
ATGGCGAGAGCAGCAAAGGCCGTGAAGGCAGCGAAGAGTGCAGCGACGGAGACGGTGAGCGCAGCGGAGACGGCAGAAGC
GGCGAAGAAGATCATGATCGTCGAGGACGAGAGGCGCATCGCACGCTTTCTGCAGATGGAGCTGGAGCACGAGGGCTTCG
AGACGGAGTCCGAGGAGAACGGACGCCGCGCCTACGAGCGCATCGTGCAGGAGCAGTACGATCTCGTGCTCCTCGACATC
ATGCTGCCCGATATGGACGGTCTTGAGGTCTGCCGCCGCGTGCGCGAGATCAGCGACGTGCCGATCATCATGCTGACGGC
GAAGGACGATGTCGAGGACAAGGTCAACGGACTCGACATCGGCGCGGACGACTACATAACGAAGCCGTTCGCCATTCAGG
AACTTCTGGCGCGCGTGCGCGCGGCGATCCGCGTGCACAAGGCGAACGAGGCGGGCAACCGCGACGAGCGCGTGCTCGCC
GTCAAGGATCTCGTGCTCTATCCGGGGCGCTACGAGGTGCGCGTCAAGGGCGATCTCGTCGAGCTGACGAAGAAGGAGTA
TTCGCTTCTCGAATACATGCTGCGCAACAAGCCCAATGTCCTCACGCGCGACCAGATCCTGCAGGAGGTCTGGGGCTACG
ACTACGTAGGCGACACGAACGTGGTCGACGTCTACATCCGCTATCTGCGTGCGAAGATTGATGAGCGTTTCGACGACAAG
TACATCTACACGGTGCGGGGCGTCGGCTATGCGATCAAGGGCTAG

Protein sequence :
MARAAKAVKAAKSAATETVSAAETAEAAKKIMIVEDERRIARFLQMELEHEGFETESEENGRRAYERIVQEQYDLVLLDI
MLPDMDGLEVCRRVREISDVPIIMLTAKDDVEDKVNGLDIGADDYITKPFAIQELLARVRAAIRVHKANEAGNRDERVLA
VKDLVLYPGRYEVRVKGDLVELTKKEYSLLEYMLRNKPNVLTRDQILQEVWGYDYVGDTNVVDVYIRYLRAKIDERFDDK
YIYTVRGVGYAIKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-48 50
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-48 50
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-48 50
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-48 50
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-48 50
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-48 50
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-48 50
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-48 50
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 9e-48 49
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 1e-45 48
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 5e-45 45
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family BAC0308 Protein 1e-38 44
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family BAC0125 Protein 8e-41 44
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 3e-33 43
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 3e-33 43
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 3e-42 43
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family BAC0638 Protein 7e-35 43
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family BAC0197 Protein 6e-41 43
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-39 43
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 3e-33 43
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family BAC0111 Protein 3e-40 42
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-41 42
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family BAC0083 Protein 9e-40 41
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family BAC0347 Protein 4e-36 41
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 8e-34 41
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 8e-34 41
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 1e-37 41
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-37 41
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-37 41
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-37 41
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-37 41
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-37 41
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-37 41
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-37 41
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-37 41
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 1e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family VFG1390 Protein 5e-43 42
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family VFG0596 Protein 4e-38 41
Selsp_2063 YP_004414469.1 two component transcriptional regulator, winged helix family VFG1386 Protein 8e-39 41