Gene Information

Name : Selsp_2105 (Selsp_2105)
Accession : YP_004414511.1
Strain : Selenomonas sputigena ATCC 35185
Genome accession: NC_015437
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 2344620 - 2345324 bp
Length : 705 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: elm:ELI_4390 response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-bindin

DNA sequence :
ATGAAACGCATCCTGATCATTGAGGACGACAAAGCGATTGCAGAGCTTGAGCGCGACTACCTCGAAGCCAACGACTTTTC
CGTGGAAATTATCTCCGACGGCAAAAATGGCGAAGAAAAGGCTCTCGCCGAAGACTTCGACCTCATCCTGCTCGACCTCA
TGCTGCCAAGTGCGGACGGCTTCGCCGTCTGCCGCGCCATCCGCCAGAAAAAAGACACGCCGATCCTCATGGTCTCGGCA
CGTCAGGAGGAAATCGACAAGGTTCGCGGCCTCGGCCTCGGCGCCGACGACTACATCGTCAAGCCCTTCAGCCCCAATGA
ACTCACGGCTCGCGTCAAGGCGCATATCGCACGCTACGAGCGCCTCACGCAAAAGACGGTACAGAAATCGGACAGCATCT
TCACCGGCGGACTCGAAATCTGCCCCGAAGCGCGCCGCGTCTTCACAGACGGCAAGGAAGTCTCTCTCACGCGCCGCGAA
TTCGATCTCCTGCTCTTCTTCGCGGAGAATCCCGGCATTGCTTTCAGCAAAGACAAGCTCTTCGACCGCATCTGGGGCAT
GGACGCCCTCGGCGACACGGCGACCGTCATGGTTCACATCAACCGCATCCGCGAAAAGATCGAACCGAACCCCGCCACGC
CCGTCTATATCGAAACCGTCTGGGGCGTCGGCTACCGATTTCAGGGCGGCGGGCACAAAGGTTAA

Protein sequence :
MKRILIIEDDKAIAELERDYLEANDFSVEIISDGKNGEEKALAEDFDLILLDLMLPSADGFAVCRAIRQKKDTPILMVSA
RQEEIDKVRGLGLGADDYIVKPFSPNELTARVKAHIARYERLTQKTVQKSDSIFTGGLEICPEARRVFTDGKEVSLTRRE
FDLLLFFAENPGIAFSKDKLFDRIWGMDALGDTATVMVHINRIREKIEPNPATPVYIETVWGVGYRFQGGGHKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-40 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-39 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-40 44
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 4e-36 43
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 3e-43 43
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 5e-43 43
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 2e-45 43
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-42 43
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 8e-36 42
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 8e-36 42
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 8e-36 42
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-32 42
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 8e-36 42
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 8e-36 42
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 8e-36 42
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 8e-36 42
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 8e-36 42
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 4e-43 42
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family NC_011595.7057856.p0 Protein 2e-35 41
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family NC_010410.6002989.p0 Protein 2e-35 41
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family NC_010400.5986590.p0 Protein 2e-34 41
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 3e-36 41
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 4e-42 41
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 3e-42 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family VFG1563 Protein 2e-40 45
Selsp_2105 YP_004414511.1 two component transcriptional regulator, winged helix family VFG1702 Protein 2e-39 44