Gene Information

Name : PT7_1097 (PT7_1097)
Accession : YP_004416261.1
Strain : Pusillimonas sp. T7-7
Genome accession: NC_015458
Putative virulence/resistance : Virulence
Product : two component heavy metal response transcriptional regulator, winged helix family protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1206423 - 1207106 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
ATGAAATTGCTCGTGGTCGAAGATGAAATCAAAACAGGTGATTACGTGCGCCAAGGACTCATAGAGTCCGGCTTCGTGGT
GGATCTCACACGCACCGGCTTGGATGGCCATCACCTGGCTCTCACGGGTTCATACGATCTCATTATCTTGGACGTCATGC
TGCCGGATGTGGATGGTTGGCGTATCGTGCAAGCATTGCGCGATGCCAAGTCGTCAACACCCGTGCTCTTTTTAACTGCC
CGGGATAGCGTTGAGGATCGAGTCAAGGGCCTGGAGTTGGGCGCAGACGATTACTTGGTAAAACCCTTCGCTTTTTCAGA
ACTTCTGGCACGGGTACGCACTTTGTTGCGACGAGGCGCCGCCCCTGCCTTTCAGGACCAGTTACAGGTAGCCGATCTCG
TGCTCGATATTCCGCGCCGCCGAGCTCAGCGTCAAAACGTGCGCATTAATCTTACGAATAAAGAGTTCGCCCTTCTAGAG
CTTCTGGTCCGTCGGCAAGGAGAAGTCTTGCCGCGCTCATTGATCGCCTCCCAAGTTTGGGATATGAACTTTGACAGCGA
TACCAATGTCATCGATGTGGCGATTCGGCGCCTACGAGCCAAGATTGACGACGACTATGAGCCTAAGCTGATTCACACGG
TGCGAGGCATGGGTTACATGCTCGATGTAACCCTTCCGGACTGA

Protein sequence :
MKLLVVEDEIKTGDYVRQGLIESGFVVDLTRTGLDGHHLALTGSYDLIILDVMLPDVDGWRIVQALRDAKSSTPVLFLTA
RDSVEDRVKGLELGADDYLVKPFAFSELLARVRTLLRRGAAPAFQDQLQVADLVLDIPRRRAQRQNVRINLTNKEFALLE
LLVRRQGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDDYEPKLIHTVRGMGYMLDVTLPD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-59 60
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 9e-59 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0111 Protein 3e-78 71
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0083 Protein 2e-72 71
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0197 Protein 7e-68 68
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0638 Protein 3e-64 68
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0308 Protein 1e-65 64
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0347 Protein 2e-68 63
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein BAC0125 Protein 2e-65 63
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_002951.3238224.p0 Protein 5e-34 41
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_007793.3914065.p0 Protein 5e-34 41
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_002758.1121390.p0 Protein 5e-34 41
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_010079.5776364.p0 Protein 5e-34 41
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_002952.2859858.p0 Protein 5e-34 41
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_007622.3794948.p0 Protein 5e-34 41
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_003923.1003417.p0 Protein 5e-34 41
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein NC_013450.8614146.p0 Protein 5e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein VFG0596 Protein 5e-60 60
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein VFG1389 Protein 8e-37 46
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein VFG1390 Protein 1e-41 44
PT7_1097 YP_004416261.1 two component heavy metal response transcriptional regulator, winged helix family protein VFG0473 Protein 8e-34 41