Gene Information

Name : PT7_3380 (PT7_3380)
Accession : YP_004418544.1
Strain : Pusillimonas sp. T7-7
Genome accession: NC_015458
Putative virulence/resistance : Resistance
Product : phosphate regulon two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3566112 - 3566813 bp
Length : 702 bp
Strand : -
Note : -

DNA sequence :
ATGAGCACTACCATACTTGTTGTAGAAGATGAGCCCGCCATCCAGGAGCTTATTTCGGTGAATCTGTCTTTTGCCGGCCA
CAAGGTGCTTCGCGCCTTCGACGCCGAGCAAGCCCAGACCCTGATCAGGGCCGAACTTCCCGATCTGATACTGCTGGACT
GGATGCTGCCCGGCGCATCAGGCATCACCTTGGCCCGCACGCTCCGTTCCGACGAACGCACACGGCATGTGCCCGTCATT
ATGCTGACCGCCAAGGGCGCCGAGCATGACAAAGTCGAAGGCCTGGAGGCCGGCGCCGACGACTACATCACCAAGCCCTT
TTCTCCCAAAGAGCTGATTGCACGCATCAAGGCCGTACTGCGCCGGCGCGCGCCCCAACTGACCGACGACATCATCCAGA
TTGGCGGACTCAAGCTGGATCCAGCCACGCACCGGGTAACGGGCGGTGGGCAGACGCTGACCGTCGGGCCGACCGAATTC
CGTCTGCTACACTTTTTCATGACACATACTGAAAGAGTGTTTTCACGCGCCCAGTTGCTGGATCAAGTCTGGGGCGACCA
TGTCTTTGTGGAAGAGCGCACCGTAGATGTACATATACGGCGCCTGCGCAAGGCCCTGGAACCCGGCAAGCTTGAAAATC
ACATTGAAACCGTGCGCGGAGCCGGATACCGGTTCACTGCGCAAATTGCGAACCCTGCCTGA

Protein sequence :
MSTTILVVEDEPAIQELISVNLSFAGHKVLRAFDAEQAQTLIRAELPDLILLDWMLPGASGITLARTLRSDERTRHVPVI
MLTAKGAEHDKVEGLEAGADDYITKPFSPKELIARIKAVLRRRAPQLTDDIIQIGGLKLDPATHRVTGGGQTLTVGPTEF
RLLHFFMTHTERVFSRAQLLDQVWGDHVFVEERTVDVHIRRLRKALEPGKLENHIETVRGAGYRFTAQIANPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 1e-33 43
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 4e-33 42
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 4e-33 42
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 4e-33 42
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 4e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator HE999704.1.gene2815. Protein 3e-39 47
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator NC_002952.2859905.p0 Protein 1e-39 45
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator NC_002951.3237708.p0 Protein 1e-39 45
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator NC_007622.3794472.p0 Protein 2e-39 45
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator NC_003923.1003749.p0 Protein 1e-39 45
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator NC_002758.1121668.p0 Protein 1e-39 45
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator NC_009641.5332272.p0 Protein 1e-39 45
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator NC_013450.8614421.p0 Protein 1e-39 45
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator NC_007793.3914279.p0 Protein 1e-39 45
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator NC_002745.1124361.p0 Protein 1e-39 45
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator NC_009782.5559369.p0 Protein 1e-39 45
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator NC_012469.1.7685629. Protein 2e-38 44
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator AE000516.2.gene3505. Protein 1e-32 43
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator AE015929.1.gene1106. Protein 3e-31 42
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator NC_012469.1.7686381. Protein 1e-33 41
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator NC_010400.5986590.p0 Protein 1e-34 41
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator NC_011595.7057856.p0 Protein 3e-34 41
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator NC_010410.6002989.p0 Protein 3e-34 41
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator BAC0039 Protein 2e-34 41
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator BAC0596 Protein 6e-35 41
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator CP000034.1.gene2186. Protein 2e-34 41
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator NC_002695.1.916589.p Protein 1e-34 41
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator CP001138.1.gene2239. Protein 6e-35 41
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator CP001918.1.gene3444. Protein 2e-34 41
PT7_3380 YP_004418544.1 phosphate regulon two-component response regulator CP000647.1.gene2531. Protein 1e-33 41