Name : Glaag_4411 (Glaag_4411) Accession : YP_004436595.1 Strain : Genome accession: NC_015498 Putative virulence/resistance : Resistance Product : mercuric transport periplasmic protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 139364 - 139639 bp Length : 276 bp Strand : - Note : KEGG: shn:Shewana3_4313 mercuric transport protein periplasmic component; TIGRFAM: mercuric transport protein periplasmic component; PFAM: Heavy metal transport/detoxification protein DNA sequence : ATGAAGAAAATTGCCTTGTTGTCTTTGCTAGCCTTGACCAGCCTGACCGCTTTTGCTGCGCCGAAAACAGTTACTTTGGA AGTCCCAACCATGAACTGTGTGACCTGCCCATTTACGGTCAAAAAGGCCTTACAAAAAGTTGAGGGTGTGAGTAAAGCTG AAGTCACCTTTGAAACAAAATTGGCAGTAGTCACTTTTGACGACGAAAAAACCACGGTAAAAGCACTGACCGAAGCCACC ACTAACGCGGGTTATCCGTCAACGCTCAAAGAGTAA Protein sequence : MKKIALLSLLALTSLTAFAAPKTVTLEVPTMNCVTCPFTVKKALQKVEGVSKAEVTFETKLAVVTFDDEKTTVKALTEAT TNAGYPSTLKE |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 5e-18 | 66 |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 7e-18 | 66 |
merP | AAN62179.1 | periplasmic mercuric ion binding protein MerP | Not tested | PAGI-2(C) | Protein | 1e-17 | 66 |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 2e-17 | 65 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 2e-17 | 65 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 2e-17 | 65 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 2e-17 | 65 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 2e-17 | 65 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 2e-17 | 65 |
unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 8e-18 | 61 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
Glaag_4411 | YP_004436595.1 | mercuric transport periplasmic protein | BAC0675 | Protein | 3e-19 | 72 |
Glaag_4411 | YP_004436595.1 | mercuric transport periplasmic protein | BAC0231 | Protein | 2e-17 | 69 |
Glaag_4411 | YP_004436595.1 | mercuric transport periplasmic protein | BAC0679 | Protein | 3e-18 | 69 |
Glaag_4411 | YP_004436595.1 | mercuric transport periplasmic protein | BAC0678 | Protein | 2e-18 | 68 |
Glaag_4411 | YP_004436595.1 | mercuric transport periplasmic protein | BAC0674 | Protein | 2e-15 | 53 |