Gene Information

Name : Thena_1465 (Thena_1465)
Accession : YP_004438208.1
Strain : Thermodesulfobium narugense DSM 14796
Genome accession: NC_015499
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1518253 - 1518930 bp
Length : 678 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: cni:Calni_0142 two component transcriptional regulator, winged helix family; PFAM: Signal transduction r

DNA sequence :
ATGAGCACAATGAGACTATTGATAGTAGAAGATGAAAAGACTCTTGCGAATTTAATAAAAAAGGGCTTTGAAGAAGAAGG
TTATGCCGTAGATGTCACATACAACGGCGAGGATGGTCTTTTTTTTGCAAAAAACAATATTTATGATGCCATAGTGCTTG
ACATTATGCTGCCAATTATTGACGGCATTAGCTTATTGAAAGAGTTAAGGGAACAAAATATTTCAACGCCAGTTATCATA
CTTACAGCTAAAGACTCTGTAAAGGATAAGGTACTCGGTTTGGACAGCGGCTCTGACGACTACCTTACAAAGCCATTCTC
TTTTGAAGAGCTGCTTTCCAGAGTAAGGGCTTTGATAAGGCGAAGATTTGCAACATCCAGCCCAATAATAAAAATTTCTG
ATTTAGTAATTGATACTGCACAAAAAACTATCAAAAGGGGCAATAAAAGAATTGATCTTAGCGCAAAGGAATATGCTCTT
CTTGAATACTTAGCCTTAAACAAAAATAAAGTAATAAGTCGCACATCAATAATCGAGCACTTATACGATGAAGATTTTGA
TTTATATAGCAACGTTATAGATGTATTTATCAATAGAATCAGGAATAAAATTGACAAAGATTTTGACAAAAAGTTGATTC
ACACATATCGTGGCATTGGTTACAGCCTAAAAGAGTGA

Protein sequence :
MSTMRLLIVEDEKTLANLIKKGFEEEGYAVDVTYNGEDGLFFAKNNIYDAIVLDIMLPIIDGISLLKELREQNISTPVII
LTAKDSVKDKVLGLDSGSDDYLTKPFSFEELLSRVRALIRRRFATSSPIIKISDLVIDTAQKTIKRGNKRIDLSAKEYAL
LEYLALNKNKVISRTSIIEHLYDEDFDLYSNVIDVFINRIRNKIDKDFDKKLIHTYRGIGYSLKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-39 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-39 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thena_1465 YP_004438208.1 two component transcriptional regulator, winged helix family BAC0308 Protein 2e-40 48
Thena_1465 YP_004438208.1 two component transcriptional regulator, winged helix family BAC0125 Protein 5e-40 46
Thena_1465 YP_004438208.1 two component transcriptional regulator, winged helix family BAC0638 Protein 4e-39 46
Thena_1465 YP_004438208.1 two component transcriptional regulator, winged helix family BAC0083 Protein 4e-37 45
Thena_1465 YP_004438208.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-30 44
Thena_1465 YP_004438208.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-30 44
Thena_1465 YP_004438208.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-30 44
Thena_1465 YP_004438208.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-30 44
Thena_1465 YP_004438208.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-30 44
Thena_1465 YP_004438208.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-30 44
Thena_1465 YP_004438208.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-30 44
Thena_1465 YP_004438208.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-30 44
Thena_1465 YP_004438208.1 two component transcriptional regulator, winged helix family BAC0111 Protein 2e-38 44
Thena_1465 YP_004438208.1 two component transcriptional regulator, winged helix family BAC0197 Protein 2e-35 44
Thena_1465 YP_004438208.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 6e-24 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thena_1465 YP_004438208.1 two component transcriptional regulator, winged helix family VFG0596 Protein 4e-40 43