Gene Information

Name : Halhy_0426 (Halhy_0426)
Accession : YP_004445210.1
Strain : Haliscomenobacter hydrossis DSM 1100
Genome accession: NC_015510
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 545141 - 545830 bp
Length : 690 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: zpr:ZPR_0969 two-component system response regulator; PFAM: Signal transduction response regulator, rece

DNA sequence :
ATGAAAAAGATCTTATTGGTTGATGATGAAGTGAGTGTAGTAAACTTCATTAAAAAAGGGCTAGCTGATGAAAACTATGA
AGTTTCGGTTGCATTTGATGGTTCTACAGGGGTTAAAATGGCTTTAGAAGCCCCATTTGACCTGATTATACTAGATATCA
TGTTGCCGGATAAAAACGGTTTGGAAGTATGTAAAGAGATACGTTTTGGTAACATTCAAACCCCGATACTTTTTCTAACC
GCATTGGGTGCCTCAGAAAATGTTGCACTGGGATTGGATATGGGGGCCGACGATTACCTCGTAAAACCTTTTAAATTCAT
TGAGCTAAATGCCAGAATAAAAGCATTGATACGTCGAGGAAAGTCTAATGATAGCCATCAACAACCGCATACCATCTACA
CCATTGCCGATCTGAAAGTGGATGATGATGCAAAAACCGTGGAACGAAATGCTAGCTTCATTTCGCTAACTGCCACGGAA
TACCGGTTATTATTGGTGCTGATCAAAAATAAGGGGAGGGTGCTTTCACGCGTAGATTTATTGGAGAGTGCATGGGATAT
TAATTTCAATATGGAAACCAATGTTGTAGATGTGTACATCAATTATTTGCGAAAAAAAATGGATACGGATGCGAACAATA
AACTCATTCATACCGTAGTAGGAATGGGCTACGTACTTAAAGAAATATGA

Protein sequence :
MKKILLVDDEVSVVNFIKKGLADENYEVSVAFDGSTGVKMALEAPFDLIILDIMLPDKNGLEVCKEIRFGNIQTPILFLT
ALGASENVALGLDMGADDYLVKPFKFIELNARIKALIRRGKSNDSHQQPHTIYTIADLKVDDDAKTVERNASFISLTATE
YRLLLVLIKNKGRVLSRVDLLESAWDINFNMETNVVDVYINYLRKKMDTDANNKLIHTVVGMGYVLKEI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-37 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-37 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-41 45
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-41 45
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-41 45
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 7e-38 45
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-41 45
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-41 45
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-41 45
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-41 45
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-41 45
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-43 45
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-37 44
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator BAC0111 Protein 4e-42 44
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator BAC0308 Protein 7e-41 43
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator BAC0347 Protein 9e-38 43
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-40 43
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-39 42
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-39 41
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-39 41
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-39 41
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-39 41
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-39 41
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-39 41
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-39 41
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-39 41
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-39 41
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator VFG0596 Protein 5e-38 43
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-43 42
Halhy_0426 YP_004445210.1 winged helix family two component transcriptional regulator VFG1389 Protein 8e-36 41