Gene Information

Name : Celf_0208 (Celf_0208)
Accession : YP_004451741.1
Strain : Cellulomonas fimi ATCC 484
Genome accession: NC_015514
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 232066 - 232641 bp
Length : 576 bp
Strand : -
Note : PFAM: stress protein; KEGG: scb:SCAB_81661 tellurium resistance protein

DNA sequence :
GTGGCTGTCAGCCTCAGCAAGGGCGGGAACGTCAGCCTGACCAAGGCGGCGCCCGGACTGACGTCCGTGGTGGTCGGTCT
GGGCTGGGACCTGCGCACGACGACCGGTGACGACTTCGACCTCGACGCGTCCGCGATCGTCGTCGGCACGGACGGCCGCG
TCCTGTCGGACAAGCACTTCGTCTTCTTCAACAACCTGACGAGCTCCGACGGCTCGGTGCAGCACCTCGGTGACAACCTC
ACCGGTGAGGGCGAGGGCGACGACGAGCAGGTCAAGGTCAGCCTCTCGACCGTTCCGGCCGAGGCCGACAAGATCGTCTT
CCCCGTCTCGATCTACGACGCCGACACGCGCGGCCAGACGTTCGGCCAGGTCCGCAACGCGTTCATCCGCGTCGTGAACG
AGGCGGACGGCGTCGAGCTGGCTCGCTACGACCTCTCGGAGGACGCGTCCACCGAGACGGCCATGGTGTTCGGCGAGCTG
TACCGCAACGGCGCCGAGTGGAAGTTCCGCGCGGTGGGCCAGGGCTACGCGTCGGGTCTCGCGGGCATCGCCCGCGACTT
CGGCGTCAGCGTCTGA

Protein sequence :
MAVSLSKGGNVSLTKAAPGLTSVVVGLGWDLRTTTGDDFDLDASAIVVGTDGRVLSDKHFVFFNNLTSSDGSVQHLGDNL
TGEGEGDDEQVKVSLSTVPAEADKIVFPVSIYDADTRGQTFGQVRNAFIRVVNEADGVELARYDLSEDASTETAMVFGEL
YRNGAEWKFRAVGQGYASGLAGIARDFGVSV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 66
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-60 66
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 66
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-60 65
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-59 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-60 65
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-57 64
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-58 62
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 5e-32 44
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-27 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Celf_0208 YP_004451741.1 stress protein BAC0390 Protein 1e-60 66
Celf_0208 YP_004451741.1 stress protein BAC0389 Protein 2e-58 62
Celf_0208 YP_004451741.1 stress protein BAC0392 Protein 2e-27 41