Gene Information

Name : TepRe1_1569 (TepRe1_1569)
Accession : YP_004461016.1
Strain : Tepidanaerobacter acetatoxydans Re1
Genome accession: NC_015519
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1605342 - 1606034 bp
Length : 693 bp
Strand : -
Note : KEGG: toc:Toce_1455 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver do

DNA sequence :
GTGCAAGGAAACGCAAGAATACTTGTAGTTGATGATGAAAAACGTATTGTAGATTTGGTGAGATTGTATTTGGAAAGGGA
AGGATTTATTGTCGATGAGGCTTTTGAAGGCCAACAGGCTCTAGACATGATATCAAGTGTATCCTATGATTTGATTATTT
TGGATCTGATGCTTCCGGTTATTGACGGTTGGACTGTTTGTAAAAAAATCAGAGAAAAATATGATACGCCTGTGATAATG
CTGACAGCTCGAGGCGAAGAATTTGACAAGGTTTTGGGGTTTGAATTAGGAGCAGATGATTATGTAGTAAAACCTTTCAG
TCCCAGAGAACTTACGGCTAGAGTTAAAGCATTATTGAGGCGTATGGCATCTAAGCAAGATTATGAAGCTGAAGCCTTGA
TTTTTCCGGAATTGTTAATTGATCCTGCAGCTAGAGTTGTTAAAGTTGATGGAAAAGAAGTTGCACTTACACCTAAGGAA
TTTGACCTATTATATTTTTTAGCTAAAAATAAAGGGAAAGCATTTAATAGAGAAAAGCTGCTAAAAGAAGTTTGGGGTTA
TGATTTTTACGGTAGTTTGCGAACTGTGGACACGCACATAAAACAACTTAGGGAAAAACTTGGCCGCAGCAAAGCTGCCT
CATATATAAATACTGTTTGGGGTATTGGCTATAAATTTGAGGTGGAAAAGTGA

Protein sequence :
MQGNARILVVDDEKRIVDLVRLYLEREGFIVDEAFEGQQALDMISSVSYDLIILDLMLPVIDGWTVCKKIREKYDTPVIM
LTARGEEFDKVLGFELGADDYVVKPFSPRELTARVKALLRRMASKQDYEAEALIFPELLIDPAARVVKVDGKEVALTPKE
FDLLYFLAKNKGKAFNREKLLKEVWGYDFYGSLRTVDTHIKQLREKLGRSKAASYINTVWGIGYKFEVEK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-40 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-40 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-49 49
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 8e-46 48
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-45 48
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-45 48
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-45 48
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-45 48
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-45 48
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-45 48
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-45 48
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-45 48
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-45 47
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-45 47
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-47 47
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 3e-41 46
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 2e-43 46
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-45 46
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-43 45
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-43 45
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-43 45
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-43 45
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-43 45
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-43 45
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-43 45
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-43 45
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-46 45
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-46 45
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-37 44
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-38 44
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 5e-44 44
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 5e-36 43
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 6e-37 43
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 4e-36 43
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 3e-44 43
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 3e-44 43
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 6e-37 43
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-35 43
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 8e-36 43
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 4e-36 43
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 2e-26 43
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 2e-36 42
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 7e-31 42
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 9e-32 42
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 9e-32 42
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 8e-36 42
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator BAC0039 Protein 1e-36 42
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator BAC0596 Protein 3e-36 42
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 1e-36 42
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 8e-37 42
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 3e-36 42
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-37 42
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 4e-38 41
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 1e-30 41
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator BAC0533 Protein 1e-30 41
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 3e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator VFG1389 Protein 7e-33 43
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator VFG1702 Protein 8e-41 42
TepRe1_1569 YP_004461016.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-40 42