Gene Information

Name : TepRe1_2606 (TepRe1_2606)
Accession : YP_004462011.1
Strain : Tepidanaerobacter acetatoxydans Re1
Genome accession: NC_015519
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2725732 - 2726421 bp
Length : 690 bp
Strand : -
Note : KEGG: toc:Toce_2236 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver do

DNA sequence :
TTGAATGAGAAGATTTTAGTGGTTGATGATGAAAAACCCATTGTAGACATTTTAAGATACAACCTTTCTAAAGAGGGGTA
TAATGTTTTGGCGGCTTATGATGGTGATGAGGCTATAAACATTGCCCTTAAAGAAGATCCAGACTTAATACTATTGGACA
TTATGCTGCCTAAGCAGGACGGTTTTTCAGTATGCAAGAAACTTAGGGAAAAAATAACTAGTCCGATAATCATGCTGACG
GCCAGAGGCGAGGAAGTAGACAAGGTTTTAGGCTTAGAGCTTGGTGCAGATGATTATATTACAAAACCCTTCAGCATGAG
AGAGCTTATGGCTCGAGTAAAAGCCAATTTGAGAAGAATTGCTCTTTCTGAGCCCGGCGGCGAAGAAGAAATTATCAGAC
TGGGAGATTTAGAGCTCGATTTAAAAAGTTATGTAGTAAGAAAAAGGGGGAAACCCCTTGATCTTACTTTTCGCGAGTAT
GAATTAATTAAATATCTTTCTACTCAGGCCGGACAGGTTTTCACCCGCGAAAAACTTTTAGAGGAAGTGTGGGGTTATGA
GTATTATGGGGATATACGCACTGTAGATGTAACTGTGCGGCGCCTTCGGGAAAAGGTGGAAGACGATCCTGCCAACCCGA
CATATATTATTACTAAACGAGGTGTGGGTTACTACTTTAGGAAGCAATAG

Protein sequence :
MNEKILVVDDEKPIVDILRYNLSKEGYNVLAAYDGDEAINIALKEDPDLILLDIMLPKQDGFSVCKKLREKITSPIIMLT
ARGEEVDKVLGLELGADDYITKPFSMRELMARVKANLRRIALSEPGGEEEIIRLGDLELDLKSYVVRKRGKPLDLTFREY
ELIKYLSTQAGQVFTREKLLEEVWGYEYYGDIRTVDVTVRRLREKVEDDPANPTYIITKRGVGYYFRKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-29 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-56 58
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-46 52
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-45 52
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-45 52
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-46 52
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-45 52
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-46 52
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-45 52
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-45 52
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-45 52
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-45 52
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-43 52
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-41 49
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 6e-42 46
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-34 46
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 1e-34 45
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 1e-34 44
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 3e-29 44
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 5e-35 44
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 5e-35 44
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 4e-31 43
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 7e-30 43
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 1e-36 43
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 3e-29 42
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 8e-23 42
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 7e-33 42
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 2e-27 41
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 2e-27 41
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 2e-27 41
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 3e-27 41
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator BAC0533 Protein 2e-27 41
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 1e-25 41
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator BAC0039 Protein 2e-25 41
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 2e-25 41
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 4e-24 41
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 4e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator VFG0596 Protein 7e-30 43
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator VFG1389 Protein 6e-27 43
TepRe1_2606 YP_004462011.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-32 42