Gene Information

Name : Mahau_1495 (Mahau_1495)
Accession : YP_004463507.1
Strain : Mahella australiensis 50-1 BON
Genome accession: NC_015520
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1572111 - 1572797 bp
Length : 687 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789: IPR001867; KEGG: cth:Cthe_1288 two component transcriptional regulator; PFAM: response regulator receiver; transcription

DNA sequence :
ATGGCTGATAATTATAAGATCTTGATTATAGACGATGATAAAAACATATGCCAATTGTTGAACTTATATTTTACCAAAGA
GGGATTTGAAGTCGATATAGCCAATAACGGCAAGGAAGGTATGAGTCATTTTTCCAACAATCCTCCCAATATCGTCATAT
TGGATATAATGTTGCCGGGTAAGGATGGCTGGGATATATGCCGTGAAATCCGAAGGATGAGCGATATACCTATTATAATG
CTTACAGCTAAAAGCGAAACTTTCGATAAAGTGCTTGGGCTGGAATTGGGTGCTGATGATTACGTTGTAAAACCATTTGA
CCCAAAAGAATTAATAGCGCGTGTAAAAGCGGTATTGAGGAGATATAACCAGGATAACGATGCTAATAACGTTATCGTTT
ACCCAAACCTTGTCATAGATAAAAATACTATGCTGGTTAAATATCAAAAGAAAGAGCTGGAATTGCCTCCAAAGGAATTT
GAGCTGCTCTACTTTTTAGCTAGCCATCCCAACAAAGTATATACGCGTGAACAACTGCTGGAACAGGTATGGGGATTTGA
TTATTATGGTGATTCAAGGACGGTGGATGTTCATGTAAATCGCTTGAGGGAAAAGATAGGGAGTGAGAATGACCCATGGA
AGATAAGTACTGTATGGGGGGTTGGATATAAATTTGAAGTTAAATAG

Protein sequence :
MADNYKILIIDDDKNICQLLNLYFTKEGFEVDIANNGKEGMSHFSNNPPNIVILDIMLPGKDGWDICREIRRMSDIPIIM
LTAKSETFDKVLGLELGADDYVVKPFDPKELIARVKAVLRRYNQDNDANNVIVYPNLVIDKNTMLVKYQKKELELPPKEF
ELLYFLASHPNKVYTREQLLEQVWGFDYYGDSRTVDVHVNRLREKIGSENDPWKISTVWGVGYKFEVK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-32 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-42 52
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 1e-34 46
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-37 46
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 7e-39 46
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-32 45
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 1e-35 45
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 3e-32 45
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 1e-35 45
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-39 45
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-39 45
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-39 45
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-39 45
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-39 45
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-39 45
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-39 45
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-39 45
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-39 45
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-39 45
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-37 44
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 4e-37 44
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-34 43
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-34 43
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-34 43
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-34 43
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-34 43
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-34 43
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-34 43
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-34 43
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 5e-39 43
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 2e-34 42
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 5e-35 42
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 5e-35 42
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 6e-35 42
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator BAC0039 Protein 5e-36 42
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 4e-36 42
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 3e-35 42
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 5e-36 42
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator BAC0596 Protein 3e-35 42
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-23 41
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-31 41
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 6e-29 41
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator BAC0111 Protein 1e-28 41
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 2e-32 41
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 4e-33 41
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 5e-36 41
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 2e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-32 41
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-32 41
Mahau_1495 YP_004463507.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-26 41