Gene Information

Name : ambt_07195 (ambt_07195)
Accession : YP_004466774.1
Strain : Alteromonas sp. SN2
Genome accession: NC_015554
Putative virulence/resistance : Virulence
Product : putative two component response regulator transcription regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1624922 - 1625605 bp
Length : 684 bp
Strand : -
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAAATTTTGGTAGTCGAGGATGAAAAGAAAATCGGTGACTATATAAAGCAAGGACTAACAGAGTCTGGATTTGTCAT
TGAACTCGTCCGCAATGGTTTAGACGGTCATCATAAAGCGATGACAGGCGAGTTTAATCTAATAATATTAGACGTCATGC
TCCCAGATATTAATGGTTGGCGGATTTTAGAATCATTACGTCAATCTGGCAATCAAACGCCGGTCTTGTTTTTGACAGCG
AGAGATAGTGTAAATGACAGAGTAAAGGGTCTAGAGTTAGGCGCTGACGATTATCTAGTCAAGCCTTTTGCTTTTGCAGA
ATTGTTGGCTAGAGTCAGAACCCTTTTTCGAAGAGGAAATACAGTAGCTGCCAACCTGCTACAAGTCGCAGACTTACAAA
TGGACATCCCGTCTCGTGTTGTAAAACGCGCTGGCCAATCCATTAATTTGACAACAAAAGAGTTTTCGCTTTTAGAACTC
ATGGTCAGAAGACAAGGAGAGGTGCTTCCTCGCTCGTTGATTGCGTCTCAAGTATGGGATATTAATTTCGACAGCGATAC
AAACGTCATCGATGTAGCGATACGCCGCTTAAGAGCTAAAATTGATGATGCATTTTCCCCTAAATTGATTCAAACGGTTC
GTGGTATGGGATACAAGTTAACAACTGATGAAGAGCAAAATTAA

Protein sequence :
MKILVVEDEKKIGDYIKQGLTESGFVIELVRNGLDGHHKAMTGEFNLIILDVMLPDINGWRILESLRQSGNQTPVLFLTA
RDSVNDRVKGLELGADDYLVKPFAFAELLARVRTLFRRGNTVAANLLQVADLQMDIPSRVVKRAGQSINLTTKEFSLLEL
MVRRQGEVLPRSLIASQVWDINFDSDTNVIDVAIRRLRAKIDDAFSPKLIQTVRGMGYKLTTDEEQN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-62 57
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-61 55

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein BAC0111 Protein 3e-73 66
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein BAC0347 Protein 1e-65 63
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein BAC0197 Protein 4e-69 63
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein BAC0083 Protein 3e-69 62
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein BAC0308 Protein 2e-67 62
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein BAC0638 Protein 7e-62 62
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein BAC0125 Protein 2e-64 59
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein HE999704.1.gene1528. Protein 3e-30 41
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein NC_010079.5776364.p0 Protein 1e-35 41
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein NC_002952.2859858.p0 Protein 1e-35 41
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein NC_007622.3794948.p0 Protein 1e-35 41
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein NC_003923.1003417.p0 Protein 1e-35 41
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein NC_013450.8614146.p0 Protein 1e-35 41
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein NC_002951.3238224.p0 Protein 1e-35 41
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein NC_007793.3914065.p0 Protein 1e-35 41
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein NC_002758.1121390.p0 Protein 1e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein VFG0596 Protein 3e-62 57
ambt_07195 YP_004466774.1 putative two component response regulator transcription regulator protein VFG1389 Protein 8e-36 41