Gene Information

Name : Thexy_1908 (Thexy_1908)
Accession : YP_004471599.1
Strain : Thermoanaerobacterium xylanolyticum LX-11
Genome accession: NC_015555
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1981291 - 1981968 bp
Length : 678 bp
Strand : -
Note : KEGG: ttm:Tthe_2212 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver do

DNA sequence :
ATGGAAAACATTTTAATTATCGATGATGAAGAAATGCTTGTAAAAGGGTTAAAGCTATCACTCATTCAAGAAGGATACTA
CGTTGATTGTGCCTATGATGGCGAAGAAGGTTTGGAAAAAATTAAAAATGGCAATTATGATTTAGTTATATTAGATTTGA
TGCTGCCGAAAATCGACGGTCTTACACTTTGCAAAGAGGTAAGGTCATTTTCAAATATACCTATTATAATGCTTACAGCA
AAAGGTGAAGATGTGGATAAGATAGTAGGCATTGAGATGGGAGCAGATGATTACCTTGCAAAGCCTTTCAACACGAGGGA
ATTGATTGCCAGAATCAGAGCTTTATTTAGAAGGACAACGACGCCTTATGTAAAAAAGCACGACGTAATCAAGTTAGGTG
ATATTACGATAAATGTTCCTGACAAAATAGTCCAGAAGAATGGCAAAGACATCGATCTTACAAATAAGGAGTTTGAATTA
TTAGTTCTTTTAGCTTCGAATCCGGGTAAGCTTTATTCTAAGGACAAACTGATGGACTTAATATGGGGATTTGACTTTTA
TGGAGATACGAATACTGTAAATGTCCATATAAGAAAGCTTAGGGAGAAAATAGAAGATGACCCGGCAAATCCAAAGCATA
TTTTCACAAAGTGGGGCTCTGGCTACTACATGAAATAG

Protein sequence :
MENILIIDDEEMLVKGLKLSLIQEGYYVDCAYDGEEGLEKIKNGNYDLVILDLMLPKIDGLTLCKEVRSFSNIPIIMLTA
KGEDVDKIVGIEMGADDYLAKPFNTRELIARIRALFRRTTTPYVKKHDVIKLGDITINVPDKIVQKNGKDIDLTNKEFEL
LVLLASNPGKLYSKDKLMDLIWGFDFYGDTNTVNVHIRKLREKIEDDPANPKHIFTKWGSGYYMK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
sboR YP_006309915.1 SboR Not tested FWisland_1 Protein 1e-33 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-39 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-39 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 6e-52 47
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 1e-40 45
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 1e-40 45
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 1e-40 45
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 1e-40 45
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 1e-40 45
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 1e-40 45
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 1e-40 45
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 1e-40 45
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 1e-35 44
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 1e-35 44
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-44 44
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 3e-44 44
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 3e-44 44
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 3e-44 44
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 3e-44 44
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 3e-44 44
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 3e-44 44
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 3e-44 44
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-44 44
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 3e-44 44
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 1e-39 44
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-38 44
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 3e-34 43
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 4e-39 43
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 7e-39 43
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family CP004022.1.gene1676. Protein 2e-35 43
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 4e-34 42
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 4e-38 42
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 2e-32 42
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family CP000034.1.gene3671. Protein 4e-39 42
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-39 42
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family BAC0125 Protein 2e-35 41
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family BAC0308 Protein 3e-37 41
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 1e-31 41
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 5e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family VFG1702 Protein 2e-39 41
Thexy_1908 YP_004471599.1 two component transcriptional regulator, winged helix family VFG1563 Protein 3e-39 41