Gene Information

Name : Thexy_2336 (Thexy_2336)
Accession : YP_004472008.1
Strain : Thermoanaerobacterium xylanolyticum LX-11
Genome accession: NC_015555
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2448295 - 2448990 bp
Length : 696 bp
Strand : -
Note : KEGG: ttm:Tthe_2686 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver do

DNA sequence :
TTGAGCAGAATCCTGATAGTAGACGATGAAAAGCCAATTGTCGAGATCTTGAAGTACAATTTAGAAAAAAATGGATACAG
CACGATAGAGGCATATGATGGGGAGGAAGGTCTTAAAATGGCTCAAGAGAAAAATCCTGACCTTATCCTCCTTGACGTCA
TGCTTCCAAAAATGGACGGTTTTACAGTTTTAAGGATATTGAGGCAGACTATGACTACACCCATATTGATGCTTACGGCA
AAGGAAGAGGAAGTAGACAAAGTATTGGGATTGGAACTGGGTGCCGACGACTATGTGACGAAGCCTTTTTCTATGAGAGA
GCTTATTGCCAGGGTAAAAGCTAATTTAAGAAGAAGCGGTATAAGCAATGGTGAGACTATGTCAAATGTTTTAAGTGTAA
ATAGCTTAAACATCGATTTGTCAAAATACAGAGTAGAGAAAAATGGAAAACCCATCGAGCTTACATCGAGAGAGTTTGAC
CTTTTAAAATTTTTGGTAGCCAACCGAGGGCTTATATTTTCGCGAGAGATGCTTTTAGAAAAGGTTTGGGGTTATGAATA
CTTTGGCGATGTAAGGACGGTGGATGTTACAATAAGGCGACTTAGAGAAAAAATTGAGGATGATCCGGCAAACCCAAGGT
ATATACATACCAAAAGAGGGGTTGGTTATTATTTTAGCGAAGAAAGTGAACTATAA

Protein sequence :
MSRILIVDDEKPIVEILKYNLEKNGYSTIEAYDGEEGLKMAQEKNPDLILLDVMLPKMDGFTVLRILRQTMTTPILMLTA
KEEEVDKVLGLELGADDYVTKPFSMRELIARVKANLRRSGISNGETMSNVLSVNSLNIDLSKYRVEKNGKPIELTSREFD
LLKFLVANRGLIFSREMLLEKVWGYEYFGDVRTVDVTIRRLREKIEDDPANPRYIHTKRGVGYYFSEESEL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-38 43
sboR YP_006309915.1 SboR Not tested FWisland_1 Protein 8e-33 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 5e-61 54
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 8e-53 51
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 1e-52 51
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 1e-52 51
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 1e-52 51
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 1e-52 51
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-52 51
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 8e-53 51
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 1e-52 51
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 1e-52 51
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 1e-52 51
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 4e-51 49
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 4e-46 48
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 2e-48 47
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 8e-43 47
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family BAC0125 Protein 3e-40 45
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family BAC0197 Protein 7e-39 45
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 3e-40 44
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 3e-40 44
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 1e-39 44
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 2e-37 43
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 2e-37 43
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 2e-37 43
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 2e-37 43
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 2e-37 43
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 2e-37 43
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 2e-37 43
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 2e-37 43
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 1e-31 43
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-36 43
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family CP000675.2.gene1535. Protein 9e-40 42
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family BAC0308 Protein 1e-35 42
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 3e-31 42
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 3e-40 42
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 3e-31 42
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 6e-26 42
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 1e-36 42
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 2e-40 42
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 1e-33 42
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family CP001485.1.gene721.p Protein 5e-35 41
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 3e-31 41
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 2e-35 41
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family BAC0111 Protein 5e-36 41
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family BAC0533 Protein 4e-31 41
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 2e-37 41
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 4e-31 41
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 3e-39 41
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 5e-34 41
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 4e-34 41
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family BAC0039 Protein 5e-34 41
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family BAC0596 Protein 5e-34 41
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 5e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family VFG1389 Protein 8e-36 45
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family VFG1386 Protein 4e-42 44
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family VFG0596 Protein 1e-38 43
Thexy_2336 YP_004472008.1 two component transcriptional regulator, winged helix family VFG1390 Protein 4e-37 42