Gene Information

Name : Thexy_0590 (Thexy_0590)
Accession : YP_004470313.1
Strain : Thermoanaerobacterium xylanolyticum LX-11
Genome accession: NC_015555
Putative virulence/resistance : Resistance
Product : copper ion binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 619588 - 619812 bp
Length : 225 bp
Strand : +
Note : KEGG: ttm:Tthe_0716 copper ion binding protein; TIGRFAM: Copper ion-binding; PFAM: Heavy metal transport/detoxification protein

DNA sequence :
ATGGGTTTGTTTGGTTCAAAAGGTGAGACTACAACGATTGATGTGAGAGGCATGTCATGCAACCATTGCAAAATGACTGT
AGAGAAAGCATTAAAAGGTCTTGATGGAGTGTCAAAAGCGACAGTAGACTTGGATAAGGCCAATGCAACTGTAACATACG
ATCCTAAAAAAGTTACTATAGATGACATGAAAAAAGCGATTATTGACGCAGGATATGAAGCTTAA

Protein sequence :
MGLFGSKGETTTIDVRGMSCNHCKMTVEKALKGLDGVSKATVDLDKANATVTYDPKKVTIDDMKKAIIDAGYEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-10 44
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-10 44
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-10 44
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 1e-09 44
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 3e-10 44
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-09 44
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-10 44
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-10 44
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 3e-09 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thexy_0590 YP_004470313.1 copper ion binding protein BAC0634 Protein 1e-07 43
Thexy_0590 YP_004470313.1 copper ion binding protein BAC0675 Protein 1e-09 42
Thexy_0590 YP_004470313.1 copper ion binding protein BAC0085 Protein 6e-04 41
Thexy_0590 YP_004470313.1 copper ion binding protein BAC0678 Protein 8e-10 41
Thexy_0590 YP_004470313.1 copper ion binding protein BAC0679 Protein 2e-09 41
Thexy_0590 YP_004470313.1 copper ion binding protein BAC0231 Protein 1e-09 41