Gene Information

Name : Psefu_1281 (Psefu_1281)
Accession : YP_004473351.1
Strain : Pseudomonas fulva 12-X
Genome accession: NC_015556
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1402520 - 1403176 bp
Length : 657 bp
Strand : -
Note : KEGG: ppf:Pput_3039 two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal transduc

DNA sequence :
ATGCGACTGCTTCTGGTGGAGGATGACCTGCCGCTCGGCGAAGGCCTGCGCGCCGGCCTGCAGGCCGAGGGCTACACCGT
CGACTGGCTGCACGACGGCGCCAGCGCGGTACACGCCCTGCTCAGCGAAACCTTCGACCTGCTGGTGCTCGACCTCGGTC
TGCCGCGCCTGAGCGGTATCCAGGTGCTGCAGCAACTGCGCAAGAGCGGCTCACACCTGCCGGTGCTGATCCTCACCGCC
CGGGACGAAACCCGCGACCGCGTCGCCGGGCTGGATGCCGGCGCCGACGATTACCTGGCCAAGCCGTTCGACCTCAACGA
ACTCAAGGCGCGCATCCGCGCCCTGCTGCGCCGCAGTGCCGGGCGCGGCCGCGCGCTGGTCGAACATGCCGGCATCACCC
TCGACCCGACCAACCAGCAGGTGCACTACGCCGGCAACCCGGTGGCACTGACGCCCAAGGAATACCTGCTCTTGCACGAG
CTGCTCGCCCACCCGGGCAAGGTGTTCACCCGCGAGCGCCTGGTGCAGCTGCTCTACGGCTGGGACGAGGAAGCGGAAAG
CAACACCCTGGAAGTGCACATCTCGCACCTGCGCAAGAAGCTGTTCAGCGAGCTGATCAGAACCGTGCGCGGCATCGGCT
ACCTGGTGGAGGCCTGA

Protein sequence :
MRLLLVEDDLPLGEGLRAGLQAEGYTVDWLHDGASAVHALLSETFDLLVLDLGLPRLSGIQVLQQLRKSGSHLPVLILTA
RDETRDRVAGLDAGADDYLAKPFDLNELKARIRALLRRSAGRGRALVEHAGITLDPTNQQVHYAGNPVALTPKEYLLLHE
LLAHPGKVFTRERLVQLLYGWDEEAESNTLEVHISHLRKKLFSELIRTVRGIGYLVEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 2e-20 45
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-17 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-16 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family BAC0487 Protein 1e-21 50
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 8e-17 45
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family BAC0308 Protein 6e-18 42
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family BAC0197 Protein 1e-18 42
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 4e-14 41
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 4e-14 41
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 4e-14 41
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 4e-14 41
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 4e-14 41
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 4e-14 41
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 4e-14 41
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 4e-14 41
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 2e-10 41
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family BAC0638 Protein 6e-14 41
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family U82965.2.orf14.gene. Protein 3e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family VFG0473 Protein 1e-23 49
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family VFG1390 Protein 2e-23 44
Psefu_1281 YP_004473351.1 two component transcriptional regulator, winged helix family VFG0596 Protein 3e-17 43