Gene Information

Name : AS9A_3568 (AS9A_3568)
Accession : YP_004494806.1
Strain : Amycolicicoccus subflavus DQS3-9A1
Genome accession: NC_015564
Putative virulence/resistance : Virulence
Product : response regulator mprA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3639154 - 3639843 bp
Length : 690 bp
Strand : -
Note : -

DNA sequence :
ATGCGGATCCTCGTTGTCGATGACGATCGTGCCGTACGTGAATCGCTGCGGCGATCATTGTCCTTTAACGGTTACACAGT
CGAACTGGCCGTGGACGGTGCTGACGCGCTCGAGAAAGTAGCGGAAGCGCCGCCCGACGCGATCGTCCTTGATGTGATGA
TGCCCAGGATGGATGGTCTCGAAGTATGCCGCCGGTTGCGCAGTCAGGGAGATGAGCGTCCCATCCTTGTCCTCACGGCG
CGTGACTCCGTCTCGGAGCGTGTTTCCGGCCTCGACGCGGGAGCAGACGACTACCTGCCCAAGCCGTTCGCTCTGGAGGA
ACTCCTGGCACGGTTGCGGGCACTGCTGCGCCGCCGCGCACCCCATGAAGGGGGTGAAGGGGTGGACACGATGGAGTTCG
CTGGATTGCGGATGGACCTCGTCACCCGCGAAGTGACCCGCAACGAGCGGTCGATCAGCCTGACCCGGACCGAGTTCTCG
CTGCTCGAGATGTTGATGGCGAACCCGCGCCGGGTTCTCACTCGAGCACGCATTCTCGAAGAAGTGTGGGGATACGATTT
TCCGACCTCGGGAAATGCGCTCGAGGTGTACATCGGCTATCTGCGGCGAAAAACTGAGTCGGAAGGGGAGCCCAGGATCA
TCCACACGGTGCGCGGCGTCGGTTACGTGCTGCGGGAAACTCCACCGTGA

Protein sequence :
MRILVVDDDRAVRESLRRSLSFNGYTVELAVDGADALEKVAEAPPDAIVLDVMMPRMDGLEVCRRLRSQGDERPILVLTA
RDSVSERVSGLDAGADDYLPKPFALEELLARLRALLRRRAPHEGGEGVDTMEFAGLRMDLVTREVTRNERSISLTRTEFS
LLEMLMANPRRVLTRARILEEVWGYDFPTSGNALEVYIGYLRRKTESEGEPRIIHTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-32 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-31 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AS9A_3568 YP_004494806.1 response regulator mprA HE999704.1.gene1528. Protein 6e-39 47
AS9A_3568 YP_004494806.1 response regulator mprA BAC0125 Protein 2e-34 45
AS9A_3568 YP_004494806.1 response regulator mprA BAC0083 Protein 1e-34 44
AS9A_3568 YP_004494806.1 response regulator mprA AE000516.2.gene3505. Protein 8e-34 43
AS9A_3568 YP_004494806.1 response regulator mprA BAC0638 Protein 8e-28 43
AS9A_3568 YP_004494806.1 response regulator mprA NC_003923.1003417.p0 Protein 4e-34 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_013450.8614146.p0 Protein 4e-34 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_002951.3238224.p0 Protein 4e-34 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_007793.3914065.p0 Protein 4e-34 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_002758.1121390.p0 Protein 4e-34 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_010079.5776364.p0 Protein 4e-34 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_002952.2859858.p0 Protein 4e-34 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_007622.3794948.p0 Protein 4e-34 42
AS9A_3568 YP_004494806.1 response regulator mprA AE015929.1.gene1106. Protein 3e-30 42
AS9A_3568 YP_004494806.1 response regulator mprA BAC0111 Protein 2e-34 42
AS9A_3568 YP_004494806.1 response regulator mprA BAC0197 Protein 1e-30 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_002952.2859905.p0 Protein 2e-35 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_002951.3237708.p0 Protein 3e-35 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_003923.1003749.p0 Protein 3e-35 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_002758.1121668.p0 Protein 3e-35 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_007622.3794472.p0 Protein 2e-35 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_009641.5332272.p0 Protein 3e-35 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_013450.8614421.p0 Protein 3e-35 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_007793.3914279.p0 Protein 3e-35 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_002745.1124361.p0 Protein 3e-35 42
AS9A_3568 YP_004494806.1 response regulator mprA NC_009782.5559369.p0 Protein 3e-35 42
AS9A_3568 YP_004494806.1 response regulator mprA U82965.2.orf14.gene. Protein 2e-23 42
AS9A_3568 YP_004494806.1 response regulator mprA BAC0347 Protein 9e-28 41
AS9A_3568 YP_004494806.1 response regulator mprA NC_012469.1.7686381. Protein 8e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AS9A_3568 YP_004494806.1 response regulator mprA VFG1390 Protein 2e-78 80
AS9A_3568 YP_004494806.1 response regulator mprA VFG1389 Protein 3e-42 51
AS9A_3568 YP_004494806.1 response regulator mprA VFG1386 Protein 2e-43 49
AS9A_3568 YP_004494806.1 response regulator mprA VFG0596 Protein 2e-32 42