Gene Information

Name : Desca_1434 (Desca_1434)
Accession : YP_004497202.1
Strain : Desulfotomaculum carboxydivorans CO-1-SRB
Genome accession: NC_015565
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1562387 - 1563079 bp
Length : 693 bp
Strand : -
Note : KEGG: drm:Dred_1903 two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal transduc

DNA sequence :
ATGCCTAAGATACTAATTATTGATGATGAAGCGAAAATCAGAGACTTAGTCAAGGTTTACTTGGTTAAGGAAGGGTTTGA
GGTCCAGGAACTCAGTGATGGCAATGAAGCAGTGAACTTAATTAAAGCAGAACATTATGACTTAGTGCTGCTTGATTTAA
TGCTGCCCGGGGTTGATGGTTTAACCATTTGCAAAGAAATCCGCAAATTCTCCCAGGTACCTGTGATAATACTTACTGCT
AGAGGAGATGAGATCGACCGGGTCATTGGTTTGGAAGTGGGGGCAGATGACTATATCGTCAAACCCTTTAGCCCCCGGGA
AATGGTGGCCAGAGTAAAGGCAGTCCTTAGGCGGATGGCACCAGGAACGGTTAATTTGCCTCAACCGGAAAGATTACTAA
CCTTCCCTGATTTAGAAATAAACCCAGAATCACGGGTAGTGGTGGTTAAAGGTCAGGAAATTTCTTTAACTCCCAGAGAG
TTTGATCTGCTGCTATTTTTAGCTAGTTTCCCCGGTCGGGCCTTTTCCCGGGAACAATTGTTAACCAATGTATGGGGTTA
TGATTATTTCGGTGACCTCCGTACCGTGGATACACATATCAACCGACTGCGGGATAAACTATCCGTTAACGGAGCCAGAC
AACCCATTGCCACTGTATGGGGTGTAGGTTATAAGTTTGAGGTGCCTAAATGA

Protein sequence :
MPKILIIDDEAKIRDLVKVYLVKEGFEVQELSDGNEAVNLIKAEHYDLVLLDLMLPGVDGLTICKEIRKFSQVPVIILTA
RGDEIDRVIGLEVGADDYIVKPFSPREMVARVKAVLRRMAPGTVNLPQPERLLTFPDLEINPESRVVVVKGQEISLTPRE
FDLLLFLASFPGRAFSREQLLTNVWGYDYFGDLRTVDTHINRLRDKLSVNGARQPIATVWGVGYKFEVPK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-44 48
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-45 48
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 9e-50 51
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-45 47
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-46 47
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-45 47
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-45 47
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-45 47
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-45 47
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-45 47
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-45 47
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-45 47
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-45 47
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-45 47
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 3e-40 47
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator BAC0596 Protein 3e-40 47
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 3e-41 46
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 2e-41 46
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 4e-40 46
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 9e-41 46
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator BAC0039 Protein 3e-41 46
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 1e-37 45
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-44 45
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 5e-40 45
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 5e-45 44
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 2e-40 44
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-45 44
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-41 44
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 3e-37 43
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 3e-37 43
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 1e-36 43
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 8e-48 43
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 4e-38 43
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 5e-40 43
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-39 43
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-39 43
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 5e-39 42
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 6e-27 42
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator BAC0533 Protein 3e-27 42
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 1e-26 42
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 3e-27 42
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 5e-32 42
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 1e-26 42
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 5e-38 42
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 5e-36 42
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 3e-23 42
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-38 41
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-38 41
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-38 41
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-38 41
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-38 41
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-38 41
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-38 41
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-38 41
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 4e-44 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator VFG1563 Protein 7e-45 48
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-45 48
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-32 43
Desca_1434 YP_004497202.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-35 41