Gene Information

Name : Desca_1634 (Desca_1634)
Accession : YP_004497394.1
Strain : Desulfotomaculum carboxydivorans CO-1-SRB
Genome accession: NC_015565
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1764193 - 1764876 bp
Length : 684 bp
Strand : -
Note : KEGG: dsy:DSY4623 hypothetical protein; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal transduction response regulat

DNA sequence :
GTGAAGAATATTTTAATTGCTGACGATGATGAGCGCATTCGGGAACTGGTGAAACTTTACTTGGAGGCCGAAGGGTTTGC
GGTGGTGGAAGCCGAGGATGGCCAACAGGTGTTAGACATAGTGAAAAAGCAGCCCATCGACCTGGTGCTGTTGGACTTGA
TGATGCCTGTACTGGACGGATGGATGGTCTGCAAAATGCTAAGACGGGAAAGAAAAATCCCCATCGTAATGCTTACGGCC
AAAGGGGAGGAAAATGACCGGGTGCTGGGGCTTGACCTGGGGGCGGACGATTATATTACCAAGCCCTTTAGTACCAGGGA
ATTGGTGGCCAGGGTGAAGGCGGTGCTGCGGCGGGCCGAAGGGGGCAAGGGGGAGGCACACATGATCTCCTACCCTGGCT
TTAAGCTAAACCAATTGACCAGGGAGTTGGAGCTAGGGGGCAACAACGTTAATCTCACCACCAAAGAGTTTGAACTCTTG
CTCACCCTGGCCAAAAACCCCGGCAGGATTTACAATCGAGATCAACTCTTGGAGCTGGTCTGGGGTTACGACTACTGCGG
TGATTCCCGGACGGTGGACACCCATATCAACCGGCTGCGGAATAAGCTGGAGAGTGAGGCTGGGCACAGCGTATTTATTA
AAACCATACGGGGAGTTGGTTACAAATTCGAAAATGGTCATTAA

Protein sequence :
MKNILIADDDERIRELVKLYLEAEGFAVVEAEDGQQVLDIVKKQPIDLVLLDLMMPVLDGWMVCKMLRRERKIPIVMLTA
KGEENDRVLGLDLGADDYITKPFSTRELVARVKAVLRRAEGGKGEAHMISYPGFKLNQLTRELELGGNNVNLTTKEFELL
LTLAKNPGRIYNRDQLLELVWGYDYCGDSRTVDTHINRLRNKLESEAGHSVFIKTIRGVGYKFENGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-32 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-35 47
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-34 46
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-29 46
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 7e-33 44
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 8e-33 44
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 1e-28 44
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator BAC0039 Protein 1e-28 44
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 9e-29 44
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-35 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-35 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-35 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-35 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-35 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-35 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-35 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-35 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-35 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-35 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 7e-23 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator BAC0533 Protein 7e-23 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 7e-23 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 7e-23 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 4e-23 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 7e-29 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator BAC0596 Protein 7e-29 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 1e-19 43
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 1e-21 42
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 3e-23 42
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 1e-28 42
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 6e-28 42
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-32 41
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 3e-27 41
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 9e-30 41
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 8e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-32 42
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-32 42
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-22 42
Desca_1634 YP_004497394.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-27 41