Gene Information

Name : Desca_2306 (Desca_2306)
Accession : YP_004498053.1
Strain : Desulfotomaculum carboxydivorans CO-1-SRB
Genome accession: NC_015565
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2423728 - 2424423 bp
Length : 696 bp
Strand : -
Note : KEGG: drm:Dred_0707 two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal transduc

DNA sequence :
ATGCCCAAAATCCTGGTTGTTGATGATGAACAACCCATCCGTGAACTGGTTAAATACAACTTGGAGCGGGAAGGTTTTGA
GGTTTTGTTGGCCGGTGACGGCAATACCGGGTTAGATATGGCCAGAACGGAGGCCCCCGACCTGATTATCCTGGATATCA
TGCTGCCGGGGATGGACGGGTTATCTGTCTGCCGGACCCTCCATCAGGAGCCTGCTACCCGGGCAATCCCAATTATTATG
CTCAGTGCCCGGGGCGAAGAGGTAGATAAGGTACTGGGGTTGGAGTTAGGGGCGGATGACTATATCACTAAGCCTTTTAG
TCCGAGGGAACTAATTGCCCGGGTCAAGGCCCGGTTACGGCGGCAAACCACCGATAACGCGATCCAGGAGACTGGTCGCA
TTGCGGTAGGGAAACTGATTATTGACCAGGACCGTTTTGTGGTTTCTGTTAACGGGGTGAAGCAAGATTTAACTCCCAAA
GAATTTGAATTACTCCGGTACTTGGCCCGGCATCCGGGTAAGGTCTTTAGCAGGGATTTACTTTTGGAACAAATTTGGGG
TTATGAGTATACCGGTGATTCCAGAACAGTGGATGTCCATATCAGGCATATCCGTCAAAAACTGGAGCAAATTCCCGGTG
CGCCCCAGTTTATCGAGACGGTCCGCGGGGTGGGTTACCGCTTTAAGGAGGGCTAA

Protein sequence :
MPKILVVDDEQPIRELVKYNLEREGFEVLLAGDGNTGLDMARTEAPDLIILDIMLPGMDGLSVCRTLHQEPATRAIPIIM
LSARGEEVDKVLGLELGADDYITKPFSPRELIARVKARLRRQTTDNAIQETGRIAVGKLIIDQDRFVVSVNGVKQDLTPK
EFELLRYLARHPGKVFSRDLLLEQIWGYEYTGDSRTVDVHIRHIRQKLEQIPGAPQFIETVRGVGYRFKEG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-43 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-44 45
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-34 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-57 53
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-57 53
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-57 53
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-57 53
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-57 53
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-57 53
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-57 53
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-57 53
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-57 53
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-57 53
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-53 52
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-57 52
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 7e-54 50
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 8e-55 49
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-44 47
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 2e-44 46
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 3e-44 46
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator BAC0039 Protein 3e-44 46
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 3e-43 45
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator BAC0596 Protein 3e-43 45
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-42 44
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-42 44
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 6e-42 44
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 2e-42 44
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 5e-43 44
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-40 43
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-40 43
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-40 43
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-40 43
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-40 43
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-40 43
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-38 43
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-40 43
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-40 43
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 5e-36 43
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 7e-36 43
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 8e-43 43
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 9e-40 43
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 7e-37 43
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 2e-40 43
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-33 41
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 2e-32 41
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator BAC0533 Protein 8e-32 41
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 2e-32 41
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 2e-32 41
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 8e-32 41
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-36 41
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 9e-28 41
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator BAC0197 Protein 7e-32 41
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 1e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-35 47
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator VFG1563 Protein 7e-44 45
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-44 45
Desca_2306 YP_004498053.1 winged helix family two component transcriptional regulator VFG0596 Protein 4e-34 42