Gene Information

Name : SerAS12_1879 (SerAS12_1879)
Accession : YP_004500316.1
Strain : Serratia sp. AS12
Genome accession: NC_015566
Putative virulence/resistance : Resistance
Product : AraC family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 2033239 - 2033595 bp
Length : 357 bp
Strand : +
Note : KEGG: spe:Spro_1931 AraC family transcriptional regulator; PFAM: Helix-turn-helix, AraC type; SMART: Helix-turn-helix, AraC domain

DNA sequence :
ATGAACAGCACGGGTTTTATTACTGATTTGATTGAGTGGATTGACAACAATCTGGAAGAGAAGCTGGATATCAATACCGT
GGCGGACCGCGCGGGATATTCCAAATGGCACCTGCAGCGTATGTTCAAACGCCAGACCGGCTACGCGTTGGGGGAGTATA
TCCGCATGCAGAAACTGAAGGTTTCCGCAGAGCGCCTGGCCAACAGCGGCGAGCCTATCGTCAGCGTGGCGATATCACTG
GGCTTTGACTCGCAGCAATCCTTCAATCGCAGTTTTAAACGGCAATTCGGCCAGACTCCGGGCGACTGGCGCCGCGCCGT
GATGCAGCCGCATATCGCCGCTAGTCGCGCACACTGA

Protein sequence :
MNSTGFITDLIEWIDNNLEEKLDINTVADRAGYSKWHLQRMFKRQTGYALGEYIRMQKLKVSAERLANSGEPIVSVAISL
GFDSQQSFNRSFKRQFGQTPGDWRRAVMQPHIAASRAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 5e-23 47
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 4e-18 44
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 4e-18 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SerAS12_1879 YP_004500316.1 AraC family transcriptional regulator CP000647.1.gene1624. Protein 3e-23 49
SerAS12_1879 YP_004500316.1 AraC family transcriptional regulator CP001918.1.gene2033. Protein 2e-23 49
SerAS12_1879 YP_004500316.1 AraC family transcriptional regulator BAC0560 Protein 3e-24 48
SerAS12_1879 YP_004500316.1 AraC family transcriptional regulator NC_002695.1.917339.p Protein 3e-24 48
SerAS12_1879 YP_004500316.1 AraC family transcriptional regulator CP000034.1.gene1596. Protein 3e-24 48
SerAS12_1879 YP_004500316.1 AraC family transcriptional regulator BAC0371 Protein 1e-23 47
SerAS12_1879 YP_004500316.1 AraC family transcriptional regulator CP001138.1.gene4488. Protein 2e-23 47
SerAS12_1879 YP_004500316.1 AraC family transcriptional regulator NC_002695.1.914293.p Protein 1e-23 47
SerAS12_1879 YP_004500316.1 AraC family transcriptional regulator CP001138.1.gene1637. Protein 6e-24 47
SerAS12_1879 YP_004500316.1 AraC family transcriptional regulator CP000034.1.gene4505. Protein 3e-23 46
SerAS12_1879 YP_004500316.1 AraC family transcriptional regulator CP001918.1.gene327.p Protein 1e-23 45
SerAS12_1879 YP_004500316.1 AraC family transcriptional regulator CP000647.1.gene4499. Protein 7e-24 45
SerAS12_1879 YP_004500316.1 AraC family transcriptional regulator CP001138.1.gene612.p Protein 3e-21 45
SerAS12_1879 YP_004500316.1 AraC family transcriptional regulator NC_010558.1.6276025. Protein 2e-18 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SerAS12_1879 YP_004500316.1 AraC family transcriptional regulator VFG0585 Protein 2e-23 47
SerAS12_1879 YP_004500316.1 AraC family transcriptional regulator VFG1038 Protein 2e-18 44