Gene Information

Name : Desku_1178 (Desku_1178)
Accession : YP_004516563.1
Strain : Desulfotomaculum kuznetsovii DSM 6115
Genome accession: NC_015573
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1193423 - 1194133 bp
Length : 711 bp
Strand : +
Note : KEGG: drm:Dred_0707 two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region

DNA sequence :
ATGGCTAAAATCCTGGTTGTGGATGATGAAGAGCATATTGTGGAGTTGATCCGCTTTAACCTGGAAAAGGAAGGTTACCA
GGTAATAGCCGCCACGGACGGGAATACCGCCATCGAAATGGCACGCTCCCAGCGGCCCGATCTCATCCTCCTTGATGTGA
TGTTGCCGGGACAGGATGGCCTGGCGGTCTGTCGCACCCTGCAGCAGGAGGCCGAAACCCGGCATATTCCGGTAATCATG
ATCAGTGCCCGGGGGGAGGAACTGGATAAGGTACTGGGTCTGGAAATGGGAGCCGACGACTACGTCACCAAGCCTTTCAG
CCCGCGGGAGCTGGTGGCCCGGGTCAAAGCCCGGTTGCGCCGGGCGCCTGGGGAAGGCGAAGGCAGGGGTGTTCGCCCTC
CGGGGGGAAGACTGGTCCGCGGGCGGCTGGTAATTGACCCGGATCGTTTCCTGGTTACCGTGGACGGCGTTAAACAGGAC
CTAACTCCGAAGGAATTCGAGTTACTGCGTTTTCTGGCCAGTGAGCCGGGAAAAGTTTTTTCCCGTGAATACCTGCTGGA
ACAGATCTGGGGTTACGATTATGCCGGGGACTCCCGGACGGTGGATGTGCATATACGCCATATCCGTCAAAAGCTGGAAC
AGGTGCCCAACGCGCCCCAGTATATTGAAACGGTGCGTGGGGTGGGTTATCGCTTCCGGGAGGTGCCTTAG

Protein sequence :
MAKILVVDDEEHIVELIRFNLEKEGYQVIAATDGNTAIEMARSQRPDLILLDVMLPGQDGLAVCRTLQQEAETRHIPVIM
ISARGEELDKVLGLEMGADDYVTKPFSPRELVARVKARLRRAPGEGEGRGVRPPGGRLVRGRLVIDPDRFLVTVDGVKQD
LTPKEFELLRFLASEPGKVFSREYLLEQIWGYDYAGDSRTVDVHIRHIRQKLEQVPNAPQYIETVRGVGYRFREVP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-34 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-46 52
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 9e-44 51
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-48 51
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-46 51
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-46 51
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-46 51
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-46 51
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-46 51
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-46 51
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-46 51
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-46 51
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-46 51
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-42 50
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-41 49
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-34 44
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 4e-32 44
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 4e-32 44
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator BAC0596 Protein 2e-31 44
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator BAC0039 Protein 5e-32 44
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 2e-31 44
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 5e-32 44
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 4e-24 42
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 4e-24 42
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-38 42
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 3e-31 42
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 9e-31 42
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 1e-26 41
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 4e-24 41
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 3e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-34 41
Desku_1178 YP_004516563.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-35 41