Gene Information

Name : Desku_2044 (Desku_2044)
Accession : YP_004517400.1
Strain : Desulfotomaculum kuznetsovii DSM 6115
Genome accession: NC_015573
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2027433 - 2028113 bp
Length : 681 bp
Strand : +
Note : KEGG: mta:Moth_1478 two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver region

DNA sequence :
ATGCGAATTCTGGTCGTTGAGGACGAAACCACCCTGGCCAATACCCTGGCCCGTTGCCTGCGGGAGGAAGGATACGCCAC
CGACATAGCCTACGACGGCGAAGAGGGGATCGCTTTCGCCGAAACAGTGGACTATGATTTGATAATTCTGGATCTCATGC
TGCCCCGGCTGGATGGTATGGAAGTTATCCGCCGCCTGCGGAATGAGCGCATTGATACCCCGGTCCTCATGCTGACGGCC
AGGGATACGGTGGCCGACAAGGTCAGGGGATTGGATGCCGGTGCCGACGATTACCTGACCAAACCCTTTGCCCTGGCTGA
ACTGCTGGCCCGCGTCCGGGCCCTGCTGCGGCGGGAAAGCGCCAACAAGAGTACTGTCCTGCAGGTCGGGGACCTGGTGA
TGGACACGGTATCCCGCCGGGTACGACGGGGAGACCGGGAAATTAACCTTACCAATAAGGAACACGCCCTGCTGGAATAC
TTAATGCGCAATCCCAACCGGGTCCTAACCCGCACCCAGATAGCCGAACACGTCTGGGATTATGACTTTAGCGGCATGTC
CAATATAGTAGATGTCTATATTCGCTACCTGCGGCGCAAGATAGACGATAATTTTGAACCCAAGTTACTGTATACCGTTC
GCGGCAGCGGCTATTGCCTCCGGGAACCTGGTAAAAGCTAG

Protein sequence :
MRILVVEDETTLANTLARCLREEGYATDIAYDGEEGIAFAETVDYDLIILDLMLPRLDGMEVIRRLRNERIDTPVLMLTA
RDTVADKVRGLDAGADDYLTKPFALAELLARVRALLRRESANKSTVLQVGDLVMDTVSRRVRRGDREINLTNKEHALLEY
LMRNPNRVLTRTQIAEHVWDYDFSGMSNIVDVYIRYLRRKIDDNFEPKLLYTVRGSGYCLREPGKS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-35 49
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-34 47
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-23 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-23 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-43 53
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator BAC0083 Protein 3e-42 53
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-40 53
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-41 51
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-37 48
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-33 46
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-33 46
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-33 46
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-33 46
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-33 46
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-33 46
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-33 46
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-33 46
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator BAC0111 Protein 9e-42 46
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 6e-28 45
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-34 45
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator BAC0347 Protein 4e-35 44
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 8e-36 44
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-30 43
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-30 43
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-30 43
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-30 43
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-30 43
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-30 43
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-30 43
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-30 43
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-30 43
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-30 43
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 4e-24 42
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 8e-24 42
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 8e-24 42
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator BAC0288 Protein 6e-29 42
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-33 42
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator BAC0487 Protein 7e-22 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-46 52
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-35 49
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator VFG1389 Protein 7e-35 45
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator VFG1386 Protein 4e-38 42
Desku_2044 YP_004517400.1 winged helix family two component transcriptional regulator VFG0473 Protein 1e-24 41