Gene Information

Name : Desku_3166 (Desku_3166)
Accession : YP_004518459.1
Strain : Desulfotomaculum kuznetsovii DSM 6115
Genome accession: NC_015573
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3175874 - 3176557 bp
Length : 684 bp
Strand : -
Note : KEGG: toc:Toce_0285 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver re

DNA sequence :
ATGGATAAAAGAATCCTTATTGTAGAGGATGAGGAAGGTACAAGAAAATATGTTCGTTTTGTTCTGGAGCAAAACGGTTT
CACCGTTTATGAAGCTGCCAGCGGGGAAGAAGCACTGGAGCTGGTGCCAGGCATACATCCTCACCTCATGCTTTTGGATG
TAAAGCTTCCGGGCATGGACGGTTACGAGGTATGTCACAAAATCAGGAATAACCACCCCGGCGTAGGTATTATCATGCTT
ACCGCCTGCGACGAGGGCATAAATAAGGTGAAGGGGCTGGAGCTGGGTGCCGATGATTATATTGTTAAGCCCTTTGATTC
ACTGGAACTGGCGGCCAGGGTAAAGGCGGTATTTCGCCGCCTTTCGCATACTCCCGGGGATATACCTGTTTCTTACAGTG
ATTTAAAAATCATCCCCTCGACCAGGCAAGTTTACAGGAAGGGGGCACCTGTTGCGCTGACGCCCAGGGAATACGACTTG
CTGCTTTTTTTGGCCCGGAACCCCAACCGGATAATCAGCAGGGAAGAGCTTTTAAACCATGTATGGGGTGATAATTATTT
GGGAGAGCTCAAAACAGTGGATATATACATCAGCAGGCTGAGGGCCAAACTGGAGGACCGGCCGGATAAACCCAGGTTAA
TTAAGACCATGCGGGGTGTCGGTTATCTTTTTAAGCCTGACTAA

Protein sequence :
MDKRILIVEDEEGTRKYVRFVLEQNGFTVYEAASGEEALELVPGIHPHLMLLDVKLPGMDGYEVCHKIRNNHPGVGIIML
TACDEGINKVKGLELGADDYIVKPFDSLELAARVKAVFRRLSHTPGDIPVSYSDLKIIPSTRQVYRKGAPVALTPREYDL
LLFLARNPNRIISREELLNHVWGDNYLGELKTVDIYISRLRAKLEDRPDKPRLIKTMRGVGYLFKPD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-34 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-46 44
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-46 44
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-46 44
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-46 44
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-46 44
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-46 44
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-46 44
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-46 44
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-46 44
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-46 44
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-41 43
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-44 43
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-39 43
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 9e-35 41
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 9e-35 41
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 9e-35 41
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 9e-35 41
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 9e-35 41
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 9e-35 41
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 9e-35 41
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 9e-35 41
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 4e-29 41
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 3e-38 41
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 2e-37 41
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 1e-39 41
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Desku_3166 YP_004518459.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-34 41