Gene Information

Name : prrA (JDM601_0823)
Accession : YP_004522077.1
Strain : Mycobacterium sp. JDM601
Genome accession: NC_015576
Putative virulence/resistance : Virulence
Product : two-component response transcriptional regulatory protein PrrA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 883268 - 883978 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
ATGAACAATCCCGCCAACGCTGCCGCCTCCCCCCGGGTACTGGTGGTCGACGACGACTCCGATGTGCTCGCCTCGCTGGA
ACGCGGACTGCGACTGTCCGGATTCGAAGTGGCGACGGCGGCCGACGGCGCCGAAGCGTTGCGCAGCGCCAAGGAGACCC
GCCCGGACGCCATCGTGCTCGACATCAACATGCCGGTGCTCGACGGCGTCAGCGTGGTGACGGCACTGCGGGCGATGGGC
GATGACGTGCCCGTCTGCGTGCTGTCCGCGCGCAGTTCGGTCGACGACCGGGTCGCCGGCCTGGAGGCAGGCGCCGACGA
CTACCTGGTCAAGCCATTCGTGCTCGCCGAGTTGGTGGCCCGGGTACGGGCGATGCTGCGGCGGCGCGGGTCGGCGGCCA
GCTCGTCGTCGGAGACCATCACGGTGGGCCCCCTGGAGGTCGACATCCCGGGCCGGCGCGCCAGGGTCAAGGGTGTCGAT
GTGGACCTGACCAAACGCGAGTTCGACCTGTTGGCCGTGCTCGCCGAGCACAAGACCGCGGTGCTCTCCCGGGCGCAGCT
CCTCGAGCTGGTGTGGGGTTACGACTTCGCCGCCGACACCAACGTCGTCGACGTGTTCATCGGCTATCTGCGGCGCAAGC
TGGAAGCCGGCGGAGCGCCACGGCTGCTGCACACCGTCCGCGGGGTCGGATTCGTCCTGCGAACGCAGTGA

Protein sequence :
MNNPANAAASPRVLVVDDDSDVLASLERGLRLSGFEVATAADGAEALRSAKETRPDAIVLDINMPVLDGVSVVTALRAMG
DDVPVCVLSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVRAMLRRRGSAASSSSETITVGPLEVDIPGRRARVKGVD
VDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEAGGAPRLLHTVRGVGFVLRTQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-24 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-24 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA BAC0083 Protein 4e-30 46
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA BAC0125 Protein 7e-29 45
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA BAC0197 Protein 7e-24 44
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA AE000516.2.gene3505. Protein 2e-28 44
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA HE999704.1.gene1528. Protein 7e-30 43
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA BAC0638 Protein 2e-22 43
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA BAC0308 Protein 9e-27 42
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_012469.1.7685629. Protein 3e-26 42
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_002952.2859905.p0 Protein 3e-26 42
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_012469.1.7686381. Protein 5e-23 42
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_002758.1121668.p0 Protein 5e-26 42
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_007622.3794472.p0 Protein 3e-26 42
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_009641.5332272.p0 Protein 5e-26 42
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_013450.8614421.p0 Protein 5e-26 42
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_007793.3914279.p0 Protein 5e-26 42
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_003923.1003749.p0 Protein 5e-26 42
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_002745.1124361.p0 Protein 5e-26 42
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_009782.5559369.p0 Protein 5e-26 42
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_002951.3237708.p0 Protein 5e-26 42
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_003923.1003417.p0 Protein 8e-31 41
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_013450.8614146.p0 Protein 8e-31 41
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_002951.3238224.p0 Protein 8e-31 41
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_007793.3914065.p0 Protein 8e-31 41
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_002758.1121390.p0 Protein 8e-31 41
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_010079.5776364.p0 Protein 8e-31 41
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_002952.2859858.p0 Protein 8e-31 41
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA NC_007622.3794948.p0 Protein 8e-31 41
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA CP001138.1.gene4273. Protein 4e-14 41
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA CP004022.1.gene3215. Protein 1e-16 41
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA HE999704.1.gene2815. Protein 5e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA VFG1389 Protein 3e-79 92
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA VFG1390 Protein 3e-40 51
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA VFG1386 Protein 1e-36 47
prrA YP_004522077.1 two-component response transcriptional regulatory protein PrrA VFG0596 Protein 8e-25 42