Gene Information

Name : mprA (JDM601_0932)
Accession : YP_004522186.1
Strain : Mycobacterium sp. JDM601
Genome accession: NC_015576
Putative virulence/resistance : Virulence
Product : two component response transcriptional regulatory protein MprA
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1005777 - 1006469 bp
Length : 693 bp
Strand : +
Note : -

DNA sequence :
ATGGCTACCCGGGTACTGGTTGTTGATGATGACCGCGCGGTGCGTGAGTCGCTGCGCAGGTCCCTGTCGTTCAATGGTTA
TTCCGTCTCGTTGGCCACCGACGGCGTCGAGGCACTTGAGGCGATCAGCAACGAACGGCCCGATGCGATGATCCTGGACG
TCATGATGCCGCGGCTGGACGGCCTGGAGGTCTGCCGTCAACTGCGCAGCACCGGTGACGACCTGCCGATTCTGGTGTTG
ACCGCCCGCGACTCGGTTTCCGAGCGGGTGGCCGGGCTGGACGCCGGCGCCGACGACTACCTGCCGAAGCCGTTTGCCCT
GGAGGAACTGCTGGCGCGGATGCGGGCGTTGCTGCGTCGCACCACCGCCGAGGACCTGTCCGAATCGGTGGCGATGTCGT
TCGAGGACCTGACGCTGGACCCGGTGACCCGCGAGGTCACCCGCGGTGACCGGCAGATCAGCCTCACCCGGACCGAATTC
GCGTTGTTGGAGATGTTGATCGCCAATCCGCGCCGCGTGCTCACCCGCAGCCGCATTCTCGAGGAGGTGTGGGGCTTCGA
CTTCCCCACCTCGGGCAATGCGCTGGAGGTCTACATCGGGTACCTGCGTCGTAAGACTGAAGCCGAAGGGGAGCCGCGGC
TGATCTACACCGTGCGCGGGGTGGGTTACGTGCTTCGCGAGACACCACCCTGA

Protein sequence :
MATRVLVVDDDRAVRESLRRSLSFNGYSVSLATDGVEALEAISNERPDAMILDVMMPRLDGLEVCRQLRSTGDDLPILVL
TARDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRTTAEDLSESVAMSFEDLTLDPVTREVTRGDRQISLTRTEF
ALLEMLIANPRRVLTRSRILEEVWGFDFPTSGNALEVYIGYLRRKTEAEGEPRLIYTVRGVGYVLRETPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-28 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA BAC0638 Protein 7e-25 46
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA HE999704.1.gene1528. Protein 1e-33 45
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA BAC0111 Protein 1e-29 44
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA BAC0125 Protein 2e-28 44
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA BAC0308 Protein 1e-29 44
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA BAC0197 Protein 5e-26 44
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA AE000516.2.gene3505. Protein 3e-30 43
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_002952.2859858.p0 Protein 4e-29 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_007622.3794948.p0 Protein 4e-29 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_003923.1003417.p0 Protein 4e-29 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_013450.8614146.p0 Protein 4e-29 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_002951.3238224.p0 Protein 4e-29 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_007793.3914065.p0 Protein 4e-29 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_002758.1121390.p0 Protein 4e-29 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_010079.5776364.p0 Protein 4e-29 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA BAC0083 Protein 8e-32 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_002952.2859905.p0 Protein 9e-31 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_009641.5332272.p0 Protein 1e-30 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_013450.8614421.p0 Protein 1e-30 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_007793.3914279.p0 Protein 1e-30 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_007622.3794472.p0 Protein 9e-31 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_002745.1124361.p0 Protein 1e-30 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_009782.5559369.p0 Protein 1e-30 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_002951.3237708.p0 Protein 1e-30 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_003923.1003749.p0 Protein 1e-30 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_002758.1121668.p0 Protein 1e-30 42
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA AE015929.1.gene1106. Protein 5e-26 41
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA NC_012469.1.7685629. Protein 2e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA VFG1390 Protein 4e-79 90
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA VFG1389 Protein 2e-42 50
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA VFG1386 Protein 7e-40 49
mprA YP_004522186.1 two component response transcriptional regulatory protein MprA VFG0596 Protein 5e-29 42