Gene Information

Name : PP1Y_Mpl8552 (PP1Y_Mpl8552)
Accession : YP_004538681.1
Strain :
Genome accession: NC_015583
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 857258 - 857557 bp
Length : 300 bp
Strand : +
Note : KEGG: acr:Acry_0785

DNA sequence :
GTGATACTAACGGGCGCGCGGGTGTGGATCGCCATGGGGCACACGGACATGCGCAAAGGGATGCAGGGGCTGGCCTTGCA
GGTCCAGCAGGGCCTGAAGCGCGACCCACACGGGGGCGACCTGTTCGTGTTTCGCGGACGGACGGGATCGCTGATCAAGA
TCATCTGGCACGACGGTATCGGCATATCCCTTCATTCCAAGCGGCTCGAGAAGGGACGCTTCGTGTGGCCCTCGGCGAAG
GACGGGATCGTCTCGCTGACCAACGCGCAATTGTCCTGCCTGCTGGAGGGGATCGACTAG

Protein sequence :
MILTGARVWIAMGHTDMRKGMQGLALQVQQGLKRDPHGGDLFVFRGRTGSLIKIIWHDGIGISLHSKRLEKGRFVWPSAK
DGIVSLTNAQLSCLLEGID

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 7e-23 59
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 1e-23 59
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 7e-23 59
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 1e-23 59
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-23 58
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-23 58
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-23 58
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-23 58
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-23 58
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-23 58
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-23 58
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-23 58
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-23 58
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 6e-23 58
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 4e-20 58
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-23 58
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 4e-23 58
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 4e-23 58
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-23 57
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-19 55
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 7e-22 52
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 7e-22 52
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 5e-21 49
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 1e-21 49
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 5e-21 49

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PP1Y_Mpl8552 YP_004538681.1 IS66 Orf2 family protein VFG0792 Protein 7e-24 58
PP1Y_Mpl8552 YP_004538681.1 IS66 Orf2 family protein VFG1698 Protein 2e-23 58
PP1Y_Mpl8552 YP_004538681.1 IS66 Orf2 family protein VFG1665 Protein 9e-24 58
PP1Y_Mpl8552 YP_004538681.1 IS66 Orf2 family protein VFG1709 Protein 7e-24 58
PP1Y_Mpl8552 YP_004538681.1 IS66 Orf2 family protein VFG1052 Protein 1e-23 57
PP1Y_Mpl8552 YP_004538681.1 IS66 Orf2 family protein VFG1517 Protein 9e-20 55
PP1Y_Mpl8552 YP_004538681.1 IS66 Orf2 family protein VFG1737 Protein 3e-22 49