Gene Information

Name : Sinme_0727 (Sinme_0727)
Accession : YP_004548100.1
Strain :
Genome accession: NC_015590
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 753029 - 753700 bp
Length : 672 bp
Strand : +
Note : KEGG: smd:Smed_0630 two component transcriptional regulator; PFAM: Signal transduction response regulator, receiver domain; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver domain; Signal transduc

DNA sequence :
ATGCGCATTCTGATCGTCGAGGACGATACCAATCTGAACAGGCAGCTGGCTGACGCTCTGAAGGAGGCCGGTTATGTCGT
CGACCAGGCTTATGACGGCGAAGAGGGCCACTATCTAGGCGATGCGGAGCCCTATGATGCGGTAATTCTCGATATAGGTC
TTCCGGAGATGGACGGCATCACCGTTCTCGAGAAATGGCGCGCAGACGGCAAGACCATGCCGGTGCTGATCCTGACGGCC
CGCGATCGATGGAGCGACAAGGTCGCAGGCATCGATGCCGGCGCCGACGATTATGTGGCGAAGCCTTTCCACGTCGAGGA
GGTGCTGGCCCGCATCCGTGCGTTGATCCGGCGGGCCGCCGGGCACGCAAGCTCCGAGATCGTCTGCGGCCCCGTCCGTC
TCGACACCAAGGGCTCCAAGGCGACCGTCGCTGGCGTCGCGCTGAAGCTCACATCGCACGAGTTCCGTCTGCTTTCCTAC
CTCATGCACCATATGGGACAGGTGGTTTCCCGCACCGAGTTGGTCGAACACATGTATGATCAGGACTTCGATCGCGATTC
CAACACGATCGAGGTTTTCATCGGCCGGCTCCGTAAGAAGATCGGCAACGATCTGATCGAAACGGTGCGCGGCCTCGGAT
ATCGCATGCAAGCACCCGGCAATGGCCATTAG

Protein sequence :
MRILIVEDDTNLNRQLADALKEAGYVVDQAYDGEEGHYLGDAEPYDAVILDIGLPEMDGITVLEKWRADGKTMPVLILTA
RDRWSDKVAGIDAGADDYVAKPFHVEEVLARIRALIRRAAGHASSEIVCGPVRLDTKGSKATVAGVALKLTSHEFRLLSY
LMHHMGQVVSRTELVEHMYDQDFDRDSNTIEVFIGRLRKKIGNDLIETVRGLGYRMQAPGNGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-27 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-38 47
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator CP000647.1.gene1136. Protein 7e-37 46
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator BAC0530 Protein 7e-37 46
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator CP001918.1.gene2526. Protein 3e-36 45
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator CP004022.1.gene1005. Protein 3e-40 45
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator BAC0487 Protein 3e-28 45
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator CP001138.1.gene1939. Protein 9e-37 44
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator NC_002695.1.913289.p Protein 3e-36 43
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator CP000034.1.gene2022. Protein 8e-37 43
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-28 42
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator BAC0111 Protein 8e-32 42
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-30 42
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator VFG0475 Protein 8e-37 44
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator VFG0473 Protein 2e-28 43
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator VFG0596 Protein 7e-28 42
Sinme_0727 YP_004548100.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-28 41