Gene Information

Name : phoB (SGPB_1793)
Accession : YP_004559888.1
Strain : Streptococcus pasteurianus ATCC 43144
Genome accession: NC_015600
Putative virulence/resistance : Virulence
Product : OmpR family two component system phosphate regulon response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1857938 - 1858615 bp
Length : 678 bp
Strand : -
Note : functional classification: COG0745(T)

DNA sequence :
ATGATTTACTGCGTTGAAGATGATGATGATATTCGAGAACTGATGCTTTATACTTTACGAACAGCAGGGTTTGAGGCTCA
GGGGTTTCCTGACTCCGTTCTATTTTGGAAAGCCATGGAAGAAGAGCAACCTAAGCTTATACTGTTAGATATCATGTTGC
CTGTAGATGATGGATTGACCATTTTAAAATCCCTACGATCAAATGGCATGACAAAAGATATTCCAGTAATCATGACAACT
GCTAAAGGAACAGAATTTGATAAAGTCAAAGGATTAGATTTGGGTGCCGATGATTATTTGGTTAAGCCGTTTGGTATGAT
GGAAATGATTTCTCGCATCAAAGCAGTTCTCAGACGTACATCAAATCAGGAACAGGAAACTCATTTGACAATAAAAAACC
TCTCTCTGGATGCAAAGAATTACACGGTTAGAAATAATGGACAAAAAATCGAATTAACTTTGAAAGAATTTGATCTGCTA
TCTTTATTGATGTTAAATCCTGGCCGTGTTTTTACGCGGCAAGAACTTTTGGATAAAGTTTGGGGAGAACACTTTATCGG
AGAAACACGGACAGTTGATGTTCATATTGGAACCCTTCGCATGAAGCTTGGAGATGCTAGTCATCTGATTAAGACAGTTC
GTGGTGTTGGTTATCGTTTGGAGGTAACAGATGATTAA

Protein sequence :
MIYCVEDDDDIRELMLYTLRTAGFEAQGFPDSVLFWKAMEEEQPKLILLDIMLPVDDGLTILKSLRSNGMTKDIPVIMTT
AKGTEFDKVKGLDLGADDYLVKPFGMMEMISRIKAVLRRTSNQEQETHLTIKNLSLDAKNYTVRNNGQKIELTLKEFDLL
SLLMLNPGRVFTRQELLDKVWGEHFIGETRTVDVHIGTLRMKLGDASHLIKTVRGVGYRLEVTDD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-30 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-29 46
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 2e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_010079.5776364.p0 Protein 5e-30 47
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_002952.2859858.p0 Protein 5e-30 47
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_007622.3794948.p0 Protein 5e-30 47
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_003923.1003417.p0 Protein 5e-30 47
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_013450.8614146.p0 Protein 5e-30 47
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_002951.3238224.p0 Protein 5e-30 47
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_007793.3914065.p0 Protein 5e-30 47
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_002758.1121390.p0 Protein 5e-30 47
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator AE015929.1.gene1106. Protein 9e-26 46
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_002952.2859905.p0 Protein 4e-41 45
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_002951.3237708.p0 Protein 5e-41 45
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_003923.1003749.p0 Protein 5e-41 45
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_002758.1121668.p0 Protein 5e-41 45
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_007622.3794472.p0 Protein 4e-41 45
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_009641.5332272.p0 Protein 5e-41 45
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_013450.8614421.p0 Protein 5e-41 45
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_007793.3914279.p0 Protein 5e-41 45
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_002745.1124361.p0 Protein 5e-41 45
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_009782.5559369.p0 Protein 5e-41 45
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator BAC0125 Protein 1e-28 45
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator BAC0197 Protein 1e-30 45
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator HE999704.1.gene1528. Protein 9e-23 44
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator BAC0533 Protein 2e-26 44
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator CP000647.1.gene4257. Protein 2e-26 44
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_012469.1.7686381. Protein 5e-35 43
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator CP001918.1.gene5135. Protein 2e-26 43
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator BAC0347 Protein 1e-29 43
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator BAC0111 Protein 2e-30 43
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator NC_002695.1.915041.p Protein 4e-26 43
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator CP000034.1.gene3834. Protein 4e-26 43
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator CP001138.1.gene4273. Protein 2e-26 43
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator BAC0083 Protein 1e-30 42
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator HE999704.1.gene2815. Protein 3e-37 41
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator CP004022.1.gene3215. Protein 8e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator VFG0596 Protein 2e-30 47
phoB YP_004559888.1 OmpR family two component system phosphate regulon response regulator VFG1389 Protein 3e-34 42