Gene Information

Name : BCO26_2947 (BCO26_2947)
Accession : YP_004570389.1
Strain : Bacillus coagulans 2-6
Genome accession: NC_015634
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3045652 - 3046362 bp
Length : 711 bp
Strand : -
Note : PFAM: Response_reg; Trans_reg_C

DNA sequence :
ATGGATAAAAAAATCTTGATCGTGGATGATGAAAAACCGATTGCCGATATTTTGCAGTTTAATTTAACAAAAGAGGGCTA
TACGGTGTTTTGCGCCTATGACGGCGAGGAAGCACTGGAAAAGGTGGAAGAAGTGCAGCCGGATTTAATTGTCCTTGATA
TTATGCTGCCAAAGCGGGATGGCATGGAAGTTTGCCGCGAAGTGCGGAAAAAATACAATATGCCGATCATTATGGTAACG
GCAAAAGACTCAGAAATTGATAAAGTGCTCGGCCTTGAGCTCGGTGCCGATGATTATGTCACAAAACCTTTCAGCACCCG
TGAACTGATTGCCCGCGTCAAAGCGAATTTGCGGCGGCACCAGCAGACGCCCCCGGCTCCGGGTGAGGAAGAGGAATCCA
ATGAAATTGCAATCGGTTCACTTGTCATTCATCCGGATGCTTATGTCGTCTCAAAACGCGGCGAGACGATTGAACTGACG
CACCGCGAATTTGAGCTGCTCCACTATCTAGCAAAGCATATCGGGCAGGTCATGACGCGCGAGCACCTGCTTGAGACCGT
GTGGGGCTATGACTATTACGGCGATGTCCGGACAGTGGACGTCACGGTCAGACGGCTCCGCGAAAAAGTGGAGGATAACC
CGAGCCATCCCGAGTGGATTGTGACAAGGCGCGGTGTCGGTTATTATTTGCGCAACCCTGAACAGGAGTAG

Protein sequence :
MDKKILIVDDEKPIADILQFNLTKEGYTVFCAYDGEEALEKVEEVQPDLIVLDIMLPKRDGMEVCREVRKKYNMPIIMVT
AKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHQQTPPAPGEEEESNEIAIGSLVIHPDAYVVSKRGETIELT
HREFELLHYLAKHIGQVMTREHLLETVWGYDYYGDVRTVDVTVRRLREKVEDNPSHPEWIVTRRGVGYYLRNPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-31 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 5e-63 69
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-54 56
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-54 56
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 7e-55 56
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-54 56
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-54 56
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-54 56
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-54 56
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-54 56
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-54 56
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-54 56
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-44 52
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-42 50
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-38 47
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-42 46
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 3e-41 46
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-35 45
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 1e-37 44
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 1e-37 44
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 5e-40 44
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-35 44
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-36 43
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-36 43
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-36 43
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-36 43
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-36 43
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-36 43
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-36 43
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-36 43
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 6e-31 43
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-28 43
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 4e-34 43
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 4e-39 43
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 5e-31 42
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 1e-37 42
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 1e-28 41
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 1e-35 41
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 9e-35 41
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 3e-35 41
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 9e-35 41
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator BAC0533 Protein 9e-35 41
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 3e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator VFG1389 Protein 6e-26 43
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator VFG1390 Protein 8e-33 41
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-31 41
BCO26_2947 YP_004570389.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-31 41