Gene Information

Name : mtrA (MLP_32550)
Accession : YP_004573672.1
Strain : Microlunatus phosphovorus NM-1
Genome accession: NC_015635
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3501477 - 3502232 bp
Length : 756 bp
Strand : -
Note : -

DNA sequence :
GTGTCGGACGCTTCGATATCGACTGACCAGCACGGTGCCCGTGACTCCGACCGGATCCAGGAGTCCCGGGCCGACCGAGG
CCGGGTGCTGGTGGTCGACGACGACGCCGCGTTGGCGGAGATGCTCTCGCTGGTGCTCCGCAACGAGGGATTCGAGCCGA
TCTGGTGCGCTCACGGGGACAAGGCTGTCGAGGCCTATCACGACGCGCGGCCGGATCTGGTGCTGCTGGATCTGATGCTG
CCCGGTAAGGACGGCGTCGCGATCTGCCGCGAGCTGCGGGCCGAGTCGCTGGTGCCCATCGTCATGCTGACCGCGAAGTC
CGACACGATCGATGTCGTCGCCGGTCTGGAGGCCGGAGCCGACGACTACGTCGCCAAGCCGTTCAAGGCCAAGGAACTGA
TCGCGCGGATCAAGACCCGACTGCGCCGCTCGCCGGAAGAGGTCGATCAAGAGACGCTGCGAATCGGCGACCTAGTGATC
AACGTCGATGGCCATACCGTCAAGCGCAACGGCGCTGCCATCCAGTTGACGCCGCTCGAGTTCGACCTGCTGCTCGCCCT
CGCTCGCAAGCCGTGGCAGGTGTTCAGCCGGGAGGTGCTGCTCGAGCAGGTCTGGGGCTACCGACACGCCGCCGACACCC
GGCTGGTCAACGTCCACGTGCAGCGGTTGCGCTCGAAGATCGAGCGTGATCCCGAGCACCCGGAGATCGTGGTGACGGTC
CGTGGCATCGGCTACAAGGCGGGCGAGCAGACATGA

Protein sequence :
MSDASISTDQHGARDSDRIQESRADRGRVLVVDDDAALAEMLSLVLRNEGFEPIWCAHGDKAVEAYHDARPDLVLLDLML
PGKDGVAICRELRAESLVPIVMLTAKSDTIDVVAGLEAGADDYVAKPFKAKELIARIKTRLRRSPEEVDQETLRIGDLVI
NVDGHTVKRNGAAIQLTPLEFDLLLALARKPWQVFSREVLLEQVWGYRHAADTRLVNVHVQRLRSKIERDPEHPEIVVTV
RGIGYKAGEQT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-36 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-36 43
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 4e-29 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 4e-29 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 4e-29 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 4e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_004573672.1 two-component system response regulator AE000516.2.gene3505. Protein 6e-70 68
mtrA YP_004573672.1 two-component system response regulator NC_003923.1003749.p0 Protein 2e-45 46
mtrA YP_004573672.1 two-component system response regulator NC_002952.2859905.p0 Protein 1e-45 45
mtrA YP_004573672.1 two-component system response regulator NC_002745.1124361.p0 Protein 2e-45 45
mtrA YP_004573672.1 two-component system response regulator NC_009782.5559369.p0 Protein 2e-45 45
mtrA YP_004573672.1 two-component system response regulator NC_002951.3237708.p0 Protein 2e-45 45
mtrA YP_004573672.1 two-component system response regulator NC_002758.1121668.p0 Protein 2e-45 45
mtrA YP_004573672.1 two-component system response regulator NC_007622.3794472.p0 Protein 1e-45 45
mtrA YP_004573672.1 two-component system response regulator NC_009641.5332272.p0 Protein 2e-45 45
mtrA YP_004573672.1 two-component system response regulator NC_013450.8614421.p0 Protein 2e-45 45
mtrA YP_004573672.1 two-component system response regulator NC_007793.3914279.p0 Protein 2e-45 45
mtrA YP_004573672.1 two-component system response regulator HE999704.1.gene2815. Protein 1e-44 44
mtrA YP_004573672.1 two-component system response regulator NC_012469.1.7685629. Protein 5e-45 44
mtrA YP_004573672.1 two-component system response regulator BAC0125 Protein 7e-32 43
mtrA YP_004573672.1 two-component system response regulator NC_012469.1.7686381. Protein 5e-42 42
mtrA YP_004573672.1 two-component system response regulator NC_013450.8614146.p0 Protein 4e-39 41
mtrA YP_004573672.1 two-component system response regulator NC_002951.3238224.p0 Protein 4e-39 41
mtrA YP_004573672.1 two-component system response regulator NC_007793.3914065.p0 Protein 4e-39 41
mtrA YP_004573672.1 two-component system response regulator NC_002758.1121390.p0 Protein 4e-39 41
mtrA YP_004573672.1 two-component system response regulator NC_010079.5776364.p0 Protein 4e-39 41
mtrA YP_004573672.1 two-component system response regulator NC_002952.2859858.p0 Protein 4e-39 41
mtrA YP_004573672.1 two-component system response regulator NC_007622.3794948.p0 Protein 4e-39 41
mtrA YP_004573672.1 two-component system response regulator NC_003923.1003417.p0 Protein 4e-39 41
mtrA YP_004573672.1 two-component system response regulator BAC0533 Protein 2e-25 41
mtrA YP_004573672.1 two-component system response regulator CP000647.1.gene4257. Protein 2e-25 41
mtrA YP_004573672.1 two-component system response regulator CP001138.1.gene2239. Protein 8e-38 41
mtrA YP_004573672.1 two-component system response regulator BAC0596 Protein 8e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
mtrA YP_004573672.1 two-component system response regulator VFG1389 Protein 3e-31 45
mtrA YP_004573672.1 two-component system response regulator VFG1563 Protein 2e-36 43
mtrA YP_004573672.1 two-component system response regulator VFG1702 Protein 1e-36 43
mtrA YP_004573672.1 two-component system response regulator VFG1390 Protein 2e-34 41