Gene Information

Name : regX (MLP_47340)
Accession : YP_004575151.1
Strain : Microlunatus phosphovorus NM-1
Genome accession: NC_015635
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5039375 - 5040052 bp
Length : 678 bp
Strand : -
Note : -

DNA sequence :
ATGACCCGCGTACTTGTCGTCGAGGACGAAGAGTCCTATCGCGATGCGCTGGCCTACATGCTGCGCAAGGAGGGTTTCGA
TGTCGTCACAGCCGCAGACGGCACTGAGGGCCTGGCTGCGTACGACCAGGGCGGTGCCGACATCGTGCTGCTTGACTTGA
TGATGCCCGGCGTGCCGGGCACCGAGGTGTGCCGACAGTTGCGGCAGCGCGGATCCGTGCCGGTGATCATGGTCACCGCG
CGGGACAGCGAGATCGACAAGGTCGTGGGCCTGGAGTTGGGCGCCGACGACTACGTCACCAAGCCGTTCAGCCAGCGTGA
ACTGGTCGCCCGGATCCGGGCGGTGCTGCGCCGCGGGCAGGAGACCGAGCTGATGCCTGATGTGGTGGAGGCACACGGCG
TCCGGATGGACATCGAGCGGCATCAGGTCTCGGTCAACGGCACTCCCGTGCGGCTGGCACTCAAGGAGTTCGAGCTGCTG
GAGCTGCTGCTCCGCAATGCCGGCCGGGTGATGACCCGCGGCCAGCTGATCGATCGGGTCTGGGGCCTGGACTACGTGGG
CGACACCAAGACCCTCGACGTGCACGTCAAGCGGCTGCGGGCCAAGATCGAGGAGGACCCGGCTCGGCCTCAACTGCTGC
AGACGGTCCGGGGACTCGGCTACAAGTTCGAGAACTGA

Protein sequence :
MTRVLVVEDEESYRDALAYMLRKEGFDVVTAADGTEGLAAYDQGGADIVLLDLMMPGVPGTEVCRQLRQRGSVPVIMVTA
RDSEIDKVVGLELGADDYVTKPFSQRELVARIRAVLRRGQETELMPDVVEAHGVRMDIERHQVSVNGTPVRLALKEFELL
ELLLRNAGRVMTRGQLIDRVWGLDYVGDTKTLDVHVKRLRAKIEEDPARPQLLQTVRGLGYKFEN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-36 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-34 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
regX YP_004575151.1 two-component system response regulator AE000516.2.gene3505. Protein 4e-38 47
regX YP_004575151.1 two-component system response regulator HE999704.1.gene2815. Protein 4e-41 46
regX YP_004575151.1 two-component system response regulator NC_012469.1.7685629. Protein 1e-45 46
regX YP_004575151.1 two-component system response regulator NC_002952.2859905.p0 Protein 7e-43 45
regX YP_004575151.1 two-component system response regulator NC_002951.3237708.p0 Protein 1e-42 45
regX YP_004575151.1 two-component system response regulator NC_002758.1121668.p0 Protein 1e-42 45
regX YP_004575151.1 two-component system response regulator NC_009641.5332272.p0 Protein 1e-42 45
regX YP_004575151.1 two-component system response regulator NC_013450.8614421.p0 Protein 1e-42 45
regX YP_004575151.1 two-component system response regulator NC_007793.3914279.p0 Protein 1e-42 45
regX YP_004575151.1 two-component system response regulator NC_003923.1003749.p0 Protein 1e-42 45
regX YP_004575151.1 two-component system response regulator NC_007622.3794472.p0 Protein 7e-43 45
regX YP_004575151.1 two-component system response regulator NC_002745.1124361.p0 Protein 1e-42 45
regX YP_004575151.1 two-component system response regulator NC_009782.5559369.p0 Protein 1e-42 45
regX YP_004575151.1 two-component system response regulator NC_012469.1.7686381. Protein 9e-42 44
regX YP_004575151.1 two-component system response regulator AE016830.1.gene1681. Protein 1e-40 43
regX YP_004575151.1 two-component system response regulator BAC0308 Protein 3e-29 42
regX YP_004575151.1 two-component system response regulator BAC0197 Protein 8e-30 42
regX YP_004575151.1 two-component system response regulator CP001918.1.gene5135. Protein 2e-23 42
regX YP_004575151.1 two-component system response regulator NC_010079.5776364.p0 Protein 4e-35 41
regX YP_004575151.1 two-component system response regulator NC_002952.2859858.p0 Protein 4e-35 41
regX YP_004575151.1 two-component system response regulator AE015929.1.gene1106. Protein 2e-29 41
regX YP_004575151.1 two-component system response regulator NC_007622.3794948.p0 Protein 4e-35 41
regX YP_004575151.1 two-component system response regulator NC_003923.1003417.p0 Protein 4e-35 41
regX YP_004575151.1 two-component system response regulator NC_013450.8614146.p0 Protein 4e-35 41
regX YP_004575151.1 two-component system response regulator NC_002951.3238224.p0 Protein 4e-35 41
regX YP_004575151.1 two-component system response regulator NC_007793.3914065.p0 Protein 4e-35 41
regX YP_004575151.1 two-component system response regulator NC_002758.1121390.p0 Protein 4e-35 41
regX YP_004575151.1 two-component system response regulator BAC0347 Protein 1e-25 41
regX YP_004575151.1 two-component system response regulator BAC0083 Protein 5e-31 41
regX YP_004575151.1 two-component system response regulator HE999704.1.gene1528. Protein 4e-25 41
regX YP_004575151.1 two-component system response regulator BAC0533 Protein 5e-26 41
regX YP_004575151.1 two-component system response regulator CP000647.1.gene4257. Protein 5e-26 41
regX YP_004575151.1 two-component system response regulator BAC0638 Protein 7e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
regX YP_004575151.1 two-component system response regulator VFG1386 Protein 2e-31 44
regX YP_004575151.1 two-component system response regulator VFG1563 Protein 3e-36 42
regX YP_004575151.1 two-component system response regulator VFG1702 Protein 4e-35 42
regX YP_004575151.1 two-component system response regulator VFG1389 Protein 2e-27 42
regX YP_004575151.1 two-component system response regulator VFG0596 Protein 6e-27 41
regX YP_004575151.1 two-component system response regulator VFG1390 Protein 9e-31 41