Gene Information

Name : Geoth_1513 (Geoth_1513)
Accession : YP_004587577.1
Strain : Geobacillus thermoglucosidasius C56-YS93
Genome accession: NC_015660
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1429460 - 1430158 bp
Length : 699 bp
Strand : +
Note : KEGG: gmc:GY4MC1_1403 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver

DNA sequence :
ATGGAAGCAAAGCGAGGGAGAAAGATGAATCATCGTGTTTTAATCATTGAAGATGAAGCGAATTTGGCGCGATTTATTGA
GCTTGATTTGACCCATGAAGGATATGAGGTGCGTGTAAGCCATGATGGCAGGGAAGGCCTGGAATTGGCGTTGTCGGAAG
AGTGGGGGCTTATTTTATTGGATGTCATGCTTCCAAGTCTGAACGGAATGGAAGTATGCCGCCGCATTCGTGCGGTAAAG
CAAACTCCGATCATTATGATTACGGCAAGAGACAGTGTGTTTGACCGTGTGATGGGTTTGGATAATGGCGCGGATGACTA
TATTGTCAAGCCATTTGCGATCGAAGAGTTGCTTGCGCGGATTCGCGCGCTATTTCGCCGCGTTCATGCTCCCGCGGAAG
AGCGTTTGCTGACGTTTAAAGATTTAACGGTGGACTTGGACGCCCGCACTGTAAAAAAAGGAAATCAATTCATTGAATTA
ACAAAGCGGGAATACGATTTATTAGTGACGTTTTTGCAAAATACGAATATTGTTTTAACCCGTGACACATTATTAGATAA
AGTATGGGGATTTGACACCGAGGTGGAAACGAACGTCGTTGATGTATATGTCCGCTATTTGCGCCATAAACTCGATGAAA
CGGATAAAGAGCGTTATATCCAAACAGTGCGGGGCGCTGGATATGTGATGCGGTCATGA

Protein sequence :
MEAKRGRKMNHRVLIIEDEANLARFIELDLTHEGYEVRVSHDGREGLELALSEEWGLILLDVMLPSLNGMEVCRRIRAVK
QTPIIMITARDSVFDRVMGLDNGADDYIVKPFAIEELLARIRALFRRVHAPAEERLLTFKDLTVDLDARTVKKGNQFIEL
TKREYDLLVTFLQNTNIVLTRDTLLDKVWGFDTEVETNVVDVYVRYLRHKLDETDKERYIQTVRGAGYVMRS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-37 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 7e-37 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-36 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-71 68
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 3e-53 57
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 9e-57 56
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 9e-57 56
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 9e-57 56
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 9e-57 56
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 9e-57 56
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 9e-57 56
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 9e-57 56
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 9e-57 56
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator BAC0308 Protein 7e-39 44
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-38 44
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-35 43
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-39 42
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-37 42
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 2e-31 41
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator BAC0638 Protein 5e-35 41
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 8e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-47 47
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator VFG0596 Protein 9e-38 44
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-37 43
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-36 41
Geoth_1513 YP_004587577.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-36 41