Gene Information

Name : Geoth_3925 (Geoth_3925)
Accession : YP_004589814.1
Strain : Geobacillus thermoglucosidasius C56-YS93
Genome accession: NC_015660
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3869632 - 3870339 bp
Length : 708 bp
Strand : -
Note : KEGG: gmc:GY4MC1_3816 two component transcriptional regulator, winged helix family; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; SMART: Signal transduction response regulator, receiver

DNA sequence :
ATGGAAAAACGAATTCTTGTTGTTGACGACGAGAAGCCAATTGCAGATATTTTGCAATTTAATTTACAAAAAGAAGGATA
TGAAGTGATTTGCGCTTATGATGGGGAGGAAGCGTTGCAAAAGGTCGAGGAAGTAATGCCGGATCTTATTTTGCTCGATA
TTATGCTTCCGCAAAAAGATGGAATGGAAGTCTGCCGCGAAGTCCGGAAAAAATACGACATGCCGATTATTATATTAACG
GCGAAAGATTCTGAAATTGACAAAGTGCTCGGTTTAGAATTAGGGGCAGACGACTATGTCACAAAGCCGTTCAGCACGAG
AGAATTGCTGGCGCGGGTGAGAGCGAATTTGCGCCGCCATTCGCAAACGGTTGCCCAAGAAGGAACGAACGATACGAATG
AGATTATCATTGGTTCTCTTGTCATCCGCCCTGATGCATACATCGTTTCCAAGCGCGGAGAAACGATCGAATTGACGCAT
CGTGAGTTTGAATTGCTTCATTATTTGGCGAAGCATATCGGACAAGTAATGACAAGGGAGCACCTGCTGCAAACGGTATG
GGGATACGATTATTACGGCGACGTCCGCACGGTGGACGTGACGGTGCGCCGGCTTCGTGAAAAAATTGAAGATAATCCAT
CGCATCCTTCATGGATCGTCACACGGCGGGGAGTCGGATATTATTTGCGCAACCCAGAACAGGAGTAA

Protein sequence :
MEKRILVVDDEKPIADILQFNLQKEGYEVICAYDGEEALQKVEEVMPDLILLDIMLPQKDGMEVCREVRKKYDMPIIILT
AKDSEIDKVLGLELGADDYVTKPFSTRELLARVRANLRRHSQTVAQEGTNDTNEIIIGSLVIRPDAYIVSKRGETIELTH
REFELLHYLAKHIGQVMTREHLLQTVWGYDYYGDVRTVDVTVRRLREKIEDNPSHPSWIVTRRGVGYYLRNPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-32 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-61 66
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-54 55
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-54 55
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-54 55
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-53 55
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-54 55
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-54 55
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-54 55
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-54 55
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 7e-54 55
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-54 55
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-40 50
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 8e-45 50
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-43 47
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-39 47
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 4e-36 46
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 4e-38 44
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 3e-30 44
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 4e-35 44
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-35 43
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-35 43
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-35 43
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-35 43
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-35 43
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-35 43
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-35 43
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-35 43
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 4e-30 43
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 2e-34 43
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 2e-34 43
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 3e-38 43
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator BAC0125 Protein 8e-29 42
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 4e-29 42
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator BAC0533 Protein 2e-33 42
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 2e-33 42
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 2e-33 42
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-23 41
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 9e-35 41
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 4e-30 41
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 9e-35 41
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 9e-35 41
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 3e-37 41
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 4e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-27 43
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-32 42
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator VFG1702 Protein 7e-33 42
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator VFG1563 Protein 5e-33 42
Geoth_3925 YP_004589814.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-30 41