Gene Information

Name : EAE_24770 (EAE_24770)
Accession : YP_004595126.1
Strain : Enterobacter aerogenes KCTC 2190
Genome accession: NC_015663
Putative virulence/resistance : Unknown
Product : putative IS602 transposase OrfA
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 5275750 - 5276097 bp
Length : 348 bp
Strand : -
Note : COG2963 Transposase and inactivated derivatives

DNA sequence :
GTGATATTCTCACCTCAACACAAAACAGGTGACTTAATGGACAAGAAAATCAAACGAACCTTCACCCCTGAGTTCAGGCT
GGAATGTGCACAGCTGATTGTTGATAAGGGCTACTCATATCGACAAGCCAGTGAAGCGATGAATGTCGGTTCAACCACGC
TTGAGAGCTGTGTACGCCAGCTCAGGCGAGAGCGCCAGGGGATTACGCCCTCTGCCACACCCATTACTCCAGACCAGCAA
CGTATCCGCGAGCTGGAAAAGCAGGTTCGCCGTCTGGAGGAACAAAATACGATATTAAAAAAGGCTACCGCGCTCTTGAT
GTCCGACTCGCTGAACGGTTCACGATAG

Protein sequence :
MIFSPQHKTGDLMDKKIKRTFTPEFRLECAQLIVDKGYSYRQASEAMNVGSTTLESCVRQLRRERQGITPSATPITPDQQ
RIRELEKQVRRLEEQNTILKKATALLMSDSLNGSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 4e-48 98
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 3e-48 98
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 3e-40 95
unnamed AAC31483.1 L0004 Not tested LEE Protein 7e-46 94
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 1e-45 94
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 1e-45 94
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 62
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-29 62
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 62
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 62
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 62
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-29 62
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 1e-29 62
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-29 62
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 9e-23 61
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 5e-23 60
l7045 CAD33744.1 - Not tested PAI I 536 Protein 5e-23 60
api80 CAF28554.1 putative transposase Not tested YAPI Protein 6e-18 55
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 3e-21 52
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 3e-18 51
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 8e-20 50
tnpA CAB61575.1 transposase A Not tested HPI Protein 8e-18 50

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EAE_24770 YP_004595126.1 putative IS602 transposase OrfA VFG0784 Protein 3e-46 94
EAE_24770 YP_004595126.1 putative IS602 transposase OrfA VFG1123 Protein 6e-30 62
EAE_24770 YP_004595126.1 putative IS602 transposase OrfA VFG1485 Protein 2e-23 60
EAE_24770 YP_004595126.1 putative IS602 transposase OrfA VFG1553 Protein 1e-21 52