Gene Information

Name : Celgi_2329 (Celgi_2329)
Accession : YP_004601397.1
Strain : Cellvibrio gilvus ATCC 13127
Genome accession: NC_015671
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2556622 - 2557362 bp
Length : 741 bp
Strand : +
Note : manually curated; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; KEGG: two component transcriptional regulator, winged helix family; SMART: response regulator receiver

DNA sequence :
ATGAGTGCGGTGAGCGGGTCACGGTCGTCGGCAACGCCGACGAAGGTGCTGGTCGTGGAGGACGAGCCGGCGATCGCGCA
GGCGATCGCGCGCCGGCTCTCGGCGGAGGGCTGGGCGGTCGAGGCCGTCGGAGACGGGCTGGCGGGCGTCGAGGCCGCCG
CGCGGATCGTTCCCGACGTGGTGGTGCTCGACGTGATGCTGCCGGGGATCGACGGGCTCGAGGTGTGCCGCCGCATCCAG
GCCGAGCGTCCCGTGCCGGTGCTGATGCTGACGGCGCGCGACGACGAGACCGACATGCTGATCGGCCTCGGCGTGGGCGC
CGACGACTACATGACCAAGCCGTTCTCGATGCGCGAGCTCGTGGCCCGCACCAAGGCGCTGCTGCGCCGCACCGAACGCG
CGACGCGTGCGCTCGAGATCGCGACGGCCGAGGCGCCCGAGCCGCCGTTGGCCGTCGGCGACGTGACGATCGACCGCGCG
CAGCGCCGCGTGGTGCGGCACGGCCAGGAGGTGCACCTCACACCGACCGAGTTCGACCTGCTCGTCGCGCTCGCCACGTC
CCCGCGCACCGTGCTGACGCGCGAGCGACTGCTCGCCGAGGTGTGGGACTGGGTGGACGCGAGCGGCACGCGCACCGTGG
ACTCGCACGTCAAGGCGCTGCGTCGCAAGCTCGGCCCGGACCTGATCCGCACCGTGCACGGCGTGGGCTACGCGTTCGAG
CCGGCCGAACCCGACGCGTGA

Protein sequence :
MSAVSGSRSSATPTKVLVVEDEPAIAQAIARRLSAEGWAVEAVGDGLAGVEAAARIVPDVVVLDVMLPGIDGLEVCRRIQ
AERPVPVLMLTARDDETDMLIGLGVGADDYMTKPFSMRELVARTKALLRRTERATRALEIATAEAPEPPLAVGDVTIDRA
QRRVVRHGQEVHLTPTEFDLLVALATSPRTVLTRERLLAEVWDWVDASGTRTVDSHVKALRRKLGPDLIRTVHGVGYAFE
PAEPDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 3e-18 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Celgi_2329 YP_004601397.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-29 43
Celgi_2329 YP_004601397.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-27 43
Celgi_2329 YP_004601397.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-28 42
Celgi_2329 YP_004601397.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-28 42
Celgi_2329 YP_004601397.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-28 42
Celgi_2329 YP_004601397.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-28 42
Celgi_2329 YP_004601397.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-28 42
Celgi_2329 YP_004601397.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-28 42
Celgi_2329 YP_004601397.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 2e-28 42
Celgi_2329 YP_004601397.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-28 42
Celgi_2329 YP_004601397.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 2e-28 42
Celgi_2329 YP_004601397.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Celgi_2329 YP_004601397.1 two component transcriptional regulator, winged helix family VFG1390 Protein 1e-27 42