Gene Information

Name : Celgi_2816 (Celgi_2816)
Accession : YP_004601878.1
Strain : Cellvibrio gilvus ATCC 13127
Genome accession: NC_015671
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3115863 - 3116528 bp
Length : 666 bp
Strand : +
Note : KEGG: bcv:Bcav_3167 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain-containing protein; SMART: response regulator receiver

DNA sequence :
ATGAGCGGCGTTCTGGTGGTCGAGGACGAGGCGCGGATCGCGTCCTTCGTCGCCAAGGGCCTGCGCGCGGCGGGCTACGC
ACCCACCGTCGTCGGGACCGCACGCGAGGCGCTCGACCTGGCGCTCAGCGGCGAGATGGACCTCATGGTGCTCGACATCG
GGCTGCCCGACGGGAACGGGTTCGACGTGCTGCGCCAGGTCCGTGCCGCGGGCTCGCGCCTGCCCGTCATCATCCTCACG
GCCCGCAGCTCGGTGGAGGACACGGTGGCCGGGCTCGAGGGCGGGGCCGACGACTACATGGCCAAGCCGTTCCGGTTCGA
GGAGCTGCTCGCGCGCGTACGGCTGCGGCTGCGCACCGACCAGGACGCGGGTGACGACACGACCGTGCTGCGCCGCGGCG
CCGTGACGCTCGACCTGCGCTCGCGCCGCGCGACCGTCGACGGGCGCGTCGTCGACCTGTCCGCGCGCGAGTTCGCGCTC
GCCGAGACGTTCCTGCGCAACGCCGGGTCGGCGCTGTCCCGCGAGCAGCTGCTCTCGCGCGTGTGGGGCTACGACTTCGA
CCCGTCGTCCAACGTGGTGGACGTCTACGTGCGGTACCTGCGGACCAAGCTGGGCGCCGGGCTCATCACGACCGTGCGGG
GCGTCGGCTACCGGTTCGAGGCGTAG

Protein sequence :
MSGVLVVEDEARIASFVAKGLRAAGYAPTVVGTAREALDLALSGEMDLMVLDIGLPDGNGFDVLRQVRAAGSRLPVIILT
ARSSVEDTVAGLEGGADDYMAKPFRFEELLARVRLRLRTDQDAGDDTTVLRRGAVTLDLRSRRATVDGRVVDLSAREFAL
AETFLRNAGSALSREQLLSRVWGYDFDPSSNVVDVYVRYLRTKLGAGLITTVRGVGYRFEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-29 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family BAC0197 Protein 3e-32 46
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 3e-35 44
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family BAC0083 Protein 3e-35 44
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family BAC0638 Protein 2e-30 44
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 7e-31 42
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 7e-31 42
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 1e-28 42
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 7e-31 42
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 7e-31 42
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 7e-31 42
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 7e-31 42
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 7e-31 42
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 7e-31 42
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family BAC0111 Protein 1e-34 42
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family BAC0347 Protein 7e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family VFG1389 Protein 4e-32 45
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family VFG0596 Protein 3e-30 42
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family VFG0473 Protein 6e-28 41
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family VFG1390 Protein 5e-33 41
Celgi_2816 YP_004601878.1 two component transcriptional regulator, winged helix family VFG1386 Protein 7e-31 41