Gene Information

Name : Thein_2220 (Thein_2220)
Accession : YP_004627032.1
Strain : Thermodesulfatator indicus DSM 15286
Genome accession: NC_015681
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2307618 - 2308313 bp
Length : 696 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: dba:Dbac_2095 two component transcriptional regulator, winged helix family; PFAM: response regulator rec

DNA sequence :
ATGCACCCTAAAGCCAAGATTTTAATCATAGAAGATGATCTCGACATAATTTACGTTCTAAAGGAACACTTAGAACTTGA
CGGCTTTGAGGTTTTAGAAGCGGAAAACGGCTTAAAAGGGCTAGAACTTGTAGAGCAAGATCCTGATTTAATAATACTTG
ACTTAAACCTTCCTGATATTGACGGCATCAAGCTCTGTCAAAAGATTCGCCAAAAAAGCGATGTTCCCATAATAATGTTA
ACCGCTCGAGATAGCCTTTCTGACAAAGTAAGAGGGCTAGAAAGTGGTGCTGATGATTATTTAGTTAAGCCTTTTGAGTA
TCTAGAAATTTTGGCTCGTATAAAAGCCTGTTTACGCCGAGCTAAAAAAATTTATAAGAAAAAGGAAATACTAGAACTAG
GGATTTTTAAAATAGATTTTAATCGCCGAGAAGTAAATATTAACGGAAAAACCATAAGACTTACCAAAAAAGAATTTGAC
CTTTTAAAAATTTTAGCCGCTCACGCCAATGAAGTCCTAACTCGGGATTTTATAAGAAGCCAGTTATGGCCCGGCAAGGA
AATTTATCCGTGGAGTAGAGCCTTAGACGTTCACATACAGCGCCTACGACAAAAAATAGAACCAGACCCCGAAAACCCTC
GATATATAATTACCCACCCTGGTGTTGGCTATCGTTTTAATCCTGAGGGAGATTAG

Protein sequence :
MHPKAKILIIEDDLDIIYVLKEHLELDGFEVLEAENGLKGLELVEQDPDLIILDLNLPDIDGIKLCQKIRQKSDVPIIML
TARDSLSDKVRGLESGADDYLVKPFEYLEILARIKACLRRAKKIYKKKEILELGIFKIDFNRREVNINGKTIRLTKKEFD
LLKILAAHANEVLTRDFIRSQLWPGKEIYPWSRALDVHIQRLRQKIEPDPENPRYIITHPGVGYRFNPEGD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-22 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-21 44
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-19 44
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 4e-15 43
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-21 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-19 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-21 41
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 6e-20 41
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 1e-24 41
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-22 43
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-20 42
Thein_2220 YP_004627032.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-22 41