Gene Information

Name : Thein_0396 (Thein_0396)
Accession : YP_004625242.1
Strain : Thermodesulfatator indicus DSM 15286
Genome accession: NC_015681
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 420822 - 421496 bp
Length : 675 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: gme:Gmet_2693 two component transcriptional regulator; PFAM: response regulator receiver; transcriptiona

DNA sequence :
ATGTCGTATATACTAATCGTAGAAGACGAACAAGATATTGCAAGATTAGTAGCTCGCACTTTAGAAAAAGAAGGGTTCAA
AACCCGTATTGCCTCTTCCCTTGCCGAAGGTCAAGAATTAATCGATAAAGAAATTCCAGAACTAGTAATCCTTGACCTGA
TGCTTCCTGATGGAAATGGTCTTGAACTCTGTAAGTACCTTCGTTTTCAGGAGAAGACAGAAATTCCCGTTATGATATTA
ACAGCCAAAGGTGAAGAGATAGATCGCATTCTTGGTTTTGAGATGGGAGCAGACGACTATATTGTGAAACCTTTTAGTCC
CAAAGAGTTGTCTTTAAGGGTTAAGGCCATTCTTAAAAGGGTTAAACAAACAGAAGCTCCCTCGGCCGCTATTACTATAG
GGCCTCTTTATATAGATCCGAATTCTATGAAAGTAAAAATAGACAAAGAAGAAATAAAACTCACTAGAACTGAATTTAAT
TTATTATTAGCTTTGGCCAAAGCTAAGGGCAAAGTACTCACTCGAGAGATACTTCTTGAAAAAGTATGGGGCTATACTTT
TGAAGGATATGCGCGTACGGTTGATACTCACGTGAGACGCCTTCGCAAAAAACTTGGCCCTTGTGCTGAAATGATAGAAA
CTGTCTGGGGCATTGGATACCGGTTTAAAGATTAA

Protein sequence :
MSYILIVEDEQDIARLVARTLEKEGFKTRIASSLAEGQELIDKEIPELVILDLMLPDGNGLELCKYLRFQEKTEIPVMIL
TAKGEEIDRILGFEMGADDYIVKPFSPKELSLRVKAILKRVKQTEAPSAAITIGPLYIDPNSMKVKIDKEEIKLTRTEFN
LLLALAKAKGKVLTREILLEKVWGYTFEGYARTVDTHVRRLRKKLGPCAEMIETVWGIGYRFKD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-37 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-36 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 9e-35 44
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-39 44
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-38 44
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-38 44
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-38 44
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-38 44
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-38 44
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-38 44
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-38 44
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-38 44
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-38 44
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-34 43
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-34 43
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-34 43
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-34 43
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-34 43
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-34 43
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-34 43
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-34 43
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-33 43
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-29 42
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 9e-28 42
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 7e-37 42
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 3e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-37 45
Thein_0396 YP_004625242.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-37 45