Gene Information

Name : Theth_0571 (Theth_0571)
Accession : YP_004659755.1
Strain : Thermotoga thermarum DSM 5069
Genome accession: NC_015707
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 575259 - 575978 bp
Length : 720 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867; KEGG: tle:Tlet_0986 two component transcriptional regulator; PFAM: response regulator receiver; transcriptiona

DNA sequence :
ATGGCTAAGAAAAGAATTTTGGTCGTTGATGACGATCCATCGATCATTGAGCTTGTAAGTTACAACCTCGCCAGAGAGGG
ATACGATGTTCTCAAAGCCTACGACGGCGAGGAAGCTTTGAAAGTCGCCGCCAACGAACCAGTGGATTTGTTCATCGTCG
ATATCATGTTACCCGGTATGGATGGTTTTGAACTTGTAAGACAGCTCAGATCAAGTGAAAAGTACAAAACAACACCGGTG
ATTTTCTTGAGCGCAAAAGGCGAGGAGTTTGACAAAGTTTTGGGACTGGAACTTGGCGCTGACGATTACATCACTAAGCC
GTTCAGCATCAGAGAATTGATAGCAAGGATCAAAGCTGTTTTCAGAAGAATCCAATTGAGTGCACAAGAAAAGGAAGAAA
GACCAAAGAAGATTGTTGCAAAAGGCTTGGAAATCGACGTTGAAAGGTACGAAGTCAGGGTCGGGGGTAAAAAAGTCAAT
TTAACCCCATTGGAATTTGAACTGCTCAGGTTCCTGGCGGAAAACGAAGGAAAAGTTTTCAACAGGGATGTTTTGCTTGA
CAAGCTTTGGGGTTATGACTACTATGGAGACACCAGAACCGTCGATGTTCACATTAGAAGACTTAGAACAAAAATTGAAG
AAGATCCTTCCAATCCGAAGTACATAATCACTGTTAGAGGGAAGGGTTACAAGTTCAGAGACCCAGGGAAGGAAGAATAA

Protein sequence :
MAKKRILVVDDDPSIIELVSYNLAREGYDVLKAYDGEEALKVAANEPVDLFIVDIMLPGMDGFELVRQLRSSEKYKTTPV
IFLSAKGEEFDKVLGLELGADDYITKPFSIRELIARIKAVFRRIQLSAQEKEERPKKIVAKGLEIDVERYEVRVGGKKVN
LTPLEFELLRFLAENEGKVFNRDVLLDKLWGYDYYGDTRTVDVHIRRLRTKIEEDPSNPKYIITVRGKGYKFRDPGKEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-42 47
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-42 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-53 49
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 4e-50 49
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-47 48
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-52 48
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-50 48
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-50 48
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-50 47
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-50 47
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-50 47
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-50 47
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-50 47
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-50 47
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-50 47
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-50 47
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 9e-48 46
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 1e-44 45
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 1e-44 45
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-41 45
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 3e-40 44
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-44 43
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-31 42
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 4e-40 42
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 8e-39 42
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-36 41
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-36 41
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-36 41
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-36 41
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-36 41
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-36 41
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-36 41
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-36 41
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator BAC0125 Protein 9e-34 41
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 6e-37 41
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator BAC0197 Protein 9e-34 41
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 6e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator VFG1563 Protein 6e-43 47
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-42 47
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-32 43
Theth_0571 YP_004659755.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-39 41