Gene Information

Name : LILAB_02055 (LILAB_02055)
Accession : YP_004663416.1
Strain : Myxococcus fulvus HW-1
Genome accession: NC_015711
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 486948 - 487649 bp
Length : 702 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAGCAGCGACAAGACGCGGCGCATCCTGGTCGTGGAGGACGACTTGTCCATCCTCACCGGCCTGTCCATGAACCTGCG
CTTCGAGGGCTACGAGGTGCTCCAGGCCCAGGATGGCCGCACCGGGCTGGCGCGCGCGCTGGACGAGTCCCCGGACCTGG
TGGTGCTGGACGTCATGCTGCCGGAGCTCAACGGCTTCGAGGTCCTCAAGGAGCTGCGCCAGCGCGGCCGGGACACCCCC
GTCGTCGTGCTGTCCGCCAAGGGCCTGGAGCCGGACAAGATTCTGGGCCTCAACCTGGGCGCGGACGACTACGTGGTGAA
GCCCTTCGGCCTCCAGGAGCTGCTGGCCCGCATCAAGGCCGTGCTGCGGCGCCGCTACCCGTCCGCGGGGGCGGGCTCGC
CGCCGCCGGTGACGTTCGGCGACGTGAGCGTGGACATGGCCGCCCGCACCGTGGCGCGCGCGGGCACGCAGGTGGAGCTC
ACCGCGCAGGAGTTCAAGCTGCTGGCGCACTTCCTGGCGCACCCGGGGCGCACCTTCACCCGCGAGGAGCTGCTGTCCGG
CGCGTGGGGCTACCACTACGAGGGCAGCGCCCGCACCGTGGACAACTTCATGCGCCAGCTCCGCCTGAAGTTCGAACCGG
ACCCGGAGGCGCCCCGCCACTTCCTCACCGTGCGCGGGCTGGGCTACCGCTTCGAGCGCTGA

Protein sequence :
MSSDKTRRILVVEDDLSILTGLSMNLRFEGYEVLQAQDGRTGLARALDESPDLVVLDVMLPELNGFEVLKELRQRGRDTP
VVVLSAKGLEPDKILGLNLGADDYVVKPFGLQELLARIKAVLRRRYPSAGAGSPPPVTFGDVSVDMAARTVARAGTQVEL
TAQEFKLLAHFLAHPGRTFTREELLSGAWGYHYEGSARTVDNFMRQLRLKFEPDPEAPRHFLTVRGLGYRFER

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LILAB_02055 YP_004663416.1 DNA-binding response regulator NC_012469.1.7685629. Protein 5e-42 45
LILAB_02055 YP_004663416.1 DNA-binding response regulator AE016830.1.gene1681. Protein 6e-45 44
LILAB_02055 YP_004663416.1 DNA-binding response regulator HE999704.1.gene2815. Protein 2e-42 44
LILAB_02055 YP_004663416.1 DNA-binding response regulator NC_012469.1.7686381. Protein 1e-38 43
LILAB_02055 YP_004663416.1 DNA-binding response regulator NC_002952.2859905.p0 Protein 3e-41 42
LILAB_02055 YP_004663416.1 DNA-binding response regulator NC_002745.1124361.p0 Protein 4e-41 42
LILAB_02055 YP_004663416.1 DNA-binding response regulator NC_009782.5559369.p0 Protein 4e-41 42
LILAB_02055 YP_004663416.1 DNA-binding response regulator NC_002951.3237708.p0 Protein 4e-41 42
LILAB_02055 YP_004663416.1 DNA-binding response regulator NC_003923.1003749.p0 Protein 4e-41 42
LILAB_02055 YP_004663416.1 DNA-binding response regulator NC_002758.1121668.p0 Protein 4e-41 42
LILAB_02055 YP_004663416.1 DNA-binding response regulator NC_007622.3794472.p0 Protein 2e-41 42
LILAB_02055 YP_004663416.1 DNA-binding response regulator NC_009641.5332272.p0 Protein 4e-41 42
LILAB_02055 YP_004663416.1 DNA-binding response regulator NC_013450.8614421.p0 Protein 4e-41 42
LILAB_02055 YP_004663416.1 DNA-binding response regulator NC_007793.3914279.p0 Protein 4e-41 42
LILAB_02055 YP_004663416.1 DNA-binding response regulator CP001485.1.gene721.p Protein 3e-35 42
LILAB_02055 YP_004663416.1 DNA-binding response regulator AE000516.2.gene3505. Protein 6e-35 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
LILAB_02055 YP_004663416.1 DNA-binding response regulator VFG1390 Protein 2e-40 43
LILAB_02055 YP_004663416.1 DNA-binding response regulator VFG1389 Protein 7e-38 43
LILAB_02055 YP_004663416.1 DNA-binding response regulator VFG1702 Protein 8e-39 41
LILAB_02055 YP_004663416.1 DNA-binding response regulator VFG1386 Protein 4e-41 41