Gene Information

Name : Nit79A3_2251 (Nit79A3_2251)
Accession : YP_004695433.1
Strain : Nitrosomonas sp. Is79A3
Genome accession: NC_015731
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator PhoB, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2407481 - 2408203 bp
Length : 723 bp
Strand : -
Note : TIGRFAM: Signal transduction response regulator, phosphate regulon transcriptional regulatory protein phoB; PFAM: Signal transduction response regulator, receiver region; Signal transduction response regulator, C-terminal; KEGG: nit:NAL212_2336 two compon

DNA sequence :
ATGACTGCAAAAATACTGATCGTGGAAGATGAAACTGCTATACAGGAATTGATTATTTATAATTTACAGCAAGCCGGTTA
TGAAACTGTCAGTGCAGAGAATGCAGAGAAGGCGATGGCAATTATCAATAACGCATTGCCGGATCTTATATTGCTGGACT
GGATGTTACCTGGAATGAGTGGTATTGAATTTGCGCGAATACTGCGGCGCGGTGAACGTACCCGGTTAATCCCCATAATT
ATGCTGACCGCGCGTACTCAGGAAACGGATAAGGTTGCAGGGCTGGAAATTGGCGCGGATGATTATATTACTAAGCCTTT
CTCGCCCCGAGAGCTGGTCGCTCGTATCAATGCAGTGCTACGCAGACTGATTCCGGAAGCTTCTGATGAAGTGGTTGAGA
TTGATGGGTTACGGCTGGATCCGGTCAATCATCGGGTGACTGCCGAGAATAAAGAAATTGAGCTAGGGCCAACTGAATAT
CGATTGTTGCATTTTATGATGACGCATACCGAACGGGTTTATTCGCGCAGTCAATTACTGGATCGGGTATGGGGTGACCA
TGTGTTTGTTGAGGAACGTACCGTCGATGTGCATATTCGCCGGTTGCGTAAAGCATTACAATTGGCAGGCAAAGATGAAT
GGATACAAACTGTCAGAGGCGCAGGTTACCGGTTCTCGGTAATTGCGGCACTACAAGCTAAAGATTTAAACACACAAATC
TGA

Protein sequence :
MTAKILIVEDETAIQELIIYNLQQAGYETVSAENAEKAMAIINNALPDLILLDWMLPGMSGIEFARILRRGERTRLIPII
MLTARTQETDKVAGLEIGADDYITKPFSPRELVARINAVLRRLIPEASDEVVEIDGLRLDPVNHRVTAENKEIELGPTEY
RLLHFMMTHTERVYSRSQLLDRVWGDHVFVEERTVDVHIRRLRKALQLAGKDEWIQTVRGAGYRFSVIAALQAKDLNTQI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-35 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family AE015929.1.gene1106. Protein 3e-31 44
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_011595.7057856.p0 Protein 1e-40 44
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_010410.6002989.p0 Protein 1e-40 44
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_010400.5986590.p0 Protein 4e-41 44
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_002952.2859905.p0 Protein 1e-41 44
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_009782.5559369.p0 Protein 2e-41 44
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_002951.3237708.p0 Protein 2e-41 44
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_003923.1003749.p0 Protein 2e-41 44
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_002758.1121668.p0 Protein 2e-41 44
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_009641.5332272.p0 Protein 2e-41 44
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_013450.8614421.p0 Protein 2e-41 44
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_007793.3914279.p0 Protein 2e-41 44
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_007622.3794472.p0 Protein 1e-41 44
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_002745.1124361.p0 Protein 2e-41 44
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family HE999704.1.gene2815. Protein 8e-44 44
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_012469.1.7686381. Protein 2e-38 43
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family AF155139.2.orf0.gene Protein 3e-39 42
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family FJ349556.1.orf0.gene Protein 1e-35 42
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family AE016830.1.gene1681. Protein 6e-42 42
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_012469.1.7685629. Protein 4e-39 42
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family CP004022.1.gene1676. Protein 6e-36 42
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_003923.1003417.p0 Protein 4e-36 41
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_013450.8614146.p0 Protein 4e-36 41
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_002951.3238224.p0 Protein 4e-36 41
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_007793.3914065.p0 Protein 4e-36 41
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_002758.1121390.p0 Protein 4e-36 41
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_010079.5776364.p0 Protein 4e-36 41
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_002952.2859858.p0 Protein 4e-36 41
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_007622.3794948.p0 Protein 4e-36 41
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family CP000647.1.gene2531. Protein 5e-39 41
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family CP000034.1.gene2186. Protein 8e-38 41
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family NC_002695.1.916589.p Protein 8e-38 41
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family CP001918.1.gene3444. Protein 1e-38 41
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family BAC0596 Protein 6e-39 41
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family BAC0039 Protein 8e-38 41
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family CP001138.1.gene2239. Protein 6e-39 41
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family CP001918.1.gene5135. Protein 4e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family VFG1563 Protein 3e-35 41
Nit79A3_2251 YP_004695433.1 two component transcriptional regulator PhoB, winged helix family VFG1702 Protein 3e-35 41