
|
Name : TPY_2814 (TPY_2814) Accession : YP_004720717.1 Strain : Sulfobacillus acidophilus TPY Genome accession: NC_015757 Putative virulence/resistance : Resistance Product : heavy metal transport/detoxification protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 2602528 - 2602734 bp Length : 207 bp Strand : - Note : - DNA sequence : ATGGAACGGGCCGAATTTGGGGTCAAGGGCATGACGTGTGATCATTGTGTGATGACGGTGACCAAAGCCCTGAAAGGGGT CGAAGGGGTCAAATTGGCGGAAGTGAGTTTGGCCGAAGAGCGCGCGAAAGTCACCTTTGACCCGACTAAAGCTTCACTGG AGCAATTAAAAGAAGCCGTCAATCAGGCCGGCTATCAGGCGCTATAG Protein sequence : MERAEFGVKGMTCDHCVMTVTKALKGVEGVKLAEVSLAEERAKVTFDPTKASLEQLKEAVNQAGYQAL |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 2e-08 | 46 |
| merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 2e-08 | 46 |
| merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 2e-08 | 46 |
| merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 2e-08 | 46 |
| merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 3e-08 | 46 |
| merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 2e-08 | 46 |
| merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 4e-08 | 41 |
| merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 2e-08 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| TPY_2814 | YP_004720717.1 | heavy metal transport/detoxification protein | BAC0085 | Protein | 5e-06 | 42 |
| TPY_2814 | YP_004720717.1 | heavy metal transport/detoxification protein | BAC0679 | Protein | 2e-08 | 41 |
| TPY_2814 | YP_004720717.1 | heavy metal transport/detoxification protein | BAC0231 | Protein | 3e-08 | 41 |
| TPY_2814 | YP_004720717.1 | heavy metal transport/detoxification protein | BAC0678 | Protein | 1e-08 | 41 |