Gene Information

Name : zobellia_4134 (zobellia_4134)
Accession : YP_004738548.1
Strain : Zobellia galactanivorans DsiJT
Genome accession: NC_015844
Putative virulence/resistance : Virulence
Product : two-component system-response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4854978 - 4855679 bp
Length : 702 bp
Strand : -
Note : The response regulator proteins are involved in the two-component signal transduction systems to detect and respond to environmental changes. These proteins consist of two domains, an N-terminal response regulator receiver domain that is substrate for a h

DNA sequence :
ATGATGAAAGAAATATTGATAATAGAAGATGATCCAGAAATCATCAAGCTTTTGGAAATCCACCTTACGGACCTTATTTA
TAAGATATCGAAGGCCATGGATGGTGCGGAAGGACTGAAAATGGCCTTGGAAAACAACTATGACCTTATACTTTTGGATT
TGACCCTTCCCAGTATGGATGGAGTTGAAATTTGCAAGAGTTTACGGGCCGAAAAGAACACGCCCATTATAATGCTTACG
GCGAAGTCGGAAGAAATTGACCGTGTTCTAGGCTTAGAGATCGGGGCCGACGACTACATTACCAAACCCTTTAGTATACG
GGAACTATTGGCCCGTATCAAGGCGGTAATGCGCCGCACGGATGTCCAAGAGGCCCAAACCGACAATACGGCTACCATTT
CTTGTGAAGGACTTTCCATAGATATAGACAAAAGAAAGGTGCTTTTGAACGATACCAAGGTGGAACTTTCTCCCAAAGAA
TTTGAACTATTGGTCTTAATGGCCTCTAATCCGGGGCGTAACTACACCCGAACCCAATTATTGAATATGATTTGGGGCTA
TAATTTTGAAGGATACGAACATACGGTAAACTCACATATCAACCGATTACGGGCCAAGATAGAATCGGATATGGCCAATC
CGGTGTATATATTAACGACTTGGGGCGTGGGCTATAAGTTTAATGAAGATATCACCTTATGA

Protein sequence :
MMKEILIIEDDPEIIKLLEIHLTDLIYKISKAMDGAEGLKMALENNYDLILLDLTLPSMDGVEICKSLRAEKNTPIIMLT
AKSEEIDRVLGLEIGADDYITKPFSIRELLARIKAVMRRTDVQEAQTDNTATISCEGLSIDIDKRKVLLNDTKVELSPKE
FELLVLMASNPGRNYTRTQLLNMIWGYNFEGYEHTVNSHINRLRAKIESDMANPVYILTTWGVGYKFNEDITL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-46 48
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-45 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
zobellia_4134 YP_004738548.1 two-component system-response regulator HE999704.1.gene2815. Protein 3e-44 48
zobellia_4134 YP_004738548.1 two-component system-response regulator AE016830.1.gene1681. Protein 9e-46 47
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_013450.8614146.p0 Protein 1e-36 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_002951.3238224.p0 Protein 1e-36 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_007793.3914065.p0 Protein 1e-36 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_002758.1121390.p0 Protein 1e-36 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_010079.5776364.p0 Protein 1e-36 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_002952.2859858.p0 Protein 1e-36 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_007622.3794948.p0 Protein 1e-36 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_003923.1003417.p0 Protein 1e-36 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_002952.2859905.p0 Protein 4e-41 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_003923.1003749.p0 Protein 4e-41 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_002758.1121668.p0 Protein 5e-41 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_007622.3794472.p0 Protein 3e-41 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_009641.5332272.p0 Protein 5e-41 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_013450.8614421.p0 Protein 5e-41 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_007793.3914279.p0 Protein 5e-41 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_002745.1124361.p0 Protein 5e-41 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_009782.5559369.p0 Protein 5e-41 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_002951.3237708.p0 Protein 5e-41 45
zobellia_4134 YP_004738548.1 two-component system-response regulator AE000516.2.gene3505. Protein 2e-37 45
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_012469.1.7686381. Protein 1e-41 44
zobellia_4134 YP_004738548.1 two-component system-response regulator NC_012469.1.7685629. Protein 4e-37 44
zobellia_4134 YP_004738548.1 two-component system-response regulator AE015929.1.gene1106. Protein 1e-29 43
zobellia_4134 YP_004738548.1 two-component system-response regulator AF155139.2.orf0.gene Protein 4e-39 43
zobellia_4134 YP_004738548.1 two-component system-response regulator CP001138.1.gene2239. Protein 1e-30 43
zobellia_4134 YP_004738548.1 two-component system-response regulator BAC0596 Protein 1e-30 43
zobellia_4134 YP_004738548.1 two-component system-response regulator HE999704.1.gene1528. Protein 8e-31 42
zobellia_4134 YP_004738548.1 two-component system-response regulator CP000647.1.gene2531. Protein 3e-30 42
zobellia_4134 YP_004738548.1 two-component system-response regulator FJ349556.1.orf0.gene Protein 1e-36 41
zobellia_4134 YP_004738548.1 two-component system-response regulator CP001485.1.gene721.p Protein 7e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
zobellia_4134 YP_004738548.1 two-component system-response regulator VFG1563 Protein 5e-46 48
zobellia_4134 YP_004738548.1 two-component system-response regulator VFG1702 Protein 2e-45 47