Gene Information

Name : rpmG (zobellia_594)
Accession : YP_004735056.1
Strain : Zobellia galactanivorans DsiJT
Genome accession: NC_015844
Putative virulence/resistance : Unknown
Product : 50S ribosomal protein L33
Function : -
COG functional category : J : Translation, ribosomal structure and biogenesis
COG ID : COG0267
EC number : -
Position : 732848 - 733030 bp
Length : 183 bp
Strand : -
Note : Ribosomal protein L33 is one of the proteins from the large ribosomal subunit (50S); L33 has been shown to be on the surface of 50S subunit; Belongs to the ribosomal protein L33p family; Localized in the cytoplasm; High confidence in function and specific

DNA sequence :
ATGGCAAAGAAAGGAAATAGAATACAGGTTATTTTGGAATGCACCGAACATAAAGATTCGGGCATGCCAGGTACTTCAAG
GTATATCACTACCAAGAACAAAAAGAACACTCCCGAAAGAATGGAGATTAAAAAGTTCAATCCTATTTTAAAGAGGATGA
CAATCCATAAGGAGATTAAATAA

Protein sequence :
MAKKGNRIQVILECTEHKDSGMPGTSRYITTKNKKNTPERMEIKKFNPILKRMTIHKEIK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ef0106 AAM75309.1 EF0106 Not tested Not named Protein 5e-07 49
rpmG NP_814353.1 50S ribosomal protein L33 Not tested Not named Protein 7e-07 49