Gene Information

Name : CFU_2527 (CFU_2527)
Accession : YP_004753177.1
Strain : Collimonas fungivorans Ter331
Genome accession: NC_015856
Putative virulence/resistance : Virulence
Product : putative response regulator for cobalt zinc cadmium resistance transcription regulator protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3000404 - 3001075 bp
Length : 672 bp
Strand : +
Note : -

DNA sequence :
ATGCGCATCCTGTTGGTGGAAGACGAGCCCAAGGCGGGCGAATACCTGCGCAAGGGACTGAGCGAATCAGGTTATGTGGT
CGACTGGGTCCGGACCGGCGCCGACGGCCTGCACTGCGCCACCACCGAAGACTATGACCTGATCGTGCTGGACGTCATGC
TGCCCGGCATGGATGGCTGGCAGGTGATCAGCGAACTGCGCAAGACCCATTCGACGCCGGTGCTGTTCCTGACCGCGCGC
GACGAAGTCGACGACCGCATCAAGGGCCTGGAGCTGGGCGCCGACGACTACCTGGTGAAACCGTTTGCATTTGCCGAACT
GGTGGCCCGGATCCGCACCCTGCTGCGGCGCGGACCGATCCGCGAAGCCGACCTGCTGCACATCGCCGACATGGAAATCG
ACGTCATGAAACGGCGCGTCACACGCAACGGCGAACGCATCGACCTCACCACCAAGGAATTTTCCCTGCTGTACCTGATG
GCCAAACGCCAGTCCGAAGTGTTGTCGCGCTCGCTGATTGCATCGCAGGTGTGGGACATGAATTTCGACAGCGACACCAA
CGTCGTCGATGTCGCCATACGGCGCTTGCGCATCAAGATCGACGAACCGTATGCGCCGCCGCTGATCCATACCGTGCGCG
GCATGGGCTACGTGCTGGAGGACCGCACTTGA

Protein sequence :
MRILLVEDEPKAGEYLRKGLSESGYVVDWVRTGADGLHCATTEDYDLIVLDVMLPGMDGWQVISELRKTHSTPVLFLTAR
DEVDDRIKGLELGADDYLVKPFAFAELVARIRTLLRRGPIREADLLHIADMEIDVMKRRVTRNGERIDLTTKEFSLLYLM
AKRQSEVLSRSLIASQVWDMNFDSDTNVVDVAIRRLRIKIDEPYAPPLIHTVRGMGYVLEDRT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-60 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-59 57

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein BAC0197 Protein 6e-78 69
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein BAC0125 Protein 8e-71 67
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein BAC0083 Protein 1e-69 64
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein BAC0308 Protein 8e-66 63
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein BAC0638 Protein 1e-62 61
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein BAC0111 Protein 2e-64 60
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein BAC0347 Protein 3e-58 56
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_007793.3914065.p0 Protein 1e-40 45
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_002758.1121390.p0 Protein 1e-40 45
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_010079.5776364.p0 Protein 1e-40 45
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_002952.2859858.p0 Protein 1e-40 45
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_007622.3794948.p0 Protein 1e-40 45
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_003923.1003417.p0 Protein 1e-40 45
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_013450.8614146.p0 Protein 1e-40 45
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_002951.3238224.p0 Protein 1e-40 45
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein AE015929.1.gene1106. Protein 1e-34 43
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein AE000516.2.gene3505. Protein 2e-32 43
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein HE999704.1.gene1528. Protein 2e-28 42
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_002952.2859905.p0 Protein 1e-33 41
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_007793.3914279.p0 Protein 8e-34 41
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_003923.1003749.p0 Protein 9e-34 41
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_002745.1124361.p0 Protein 8e-34 41
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_009782.5559369.p0 Protein 8e-34 41
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_002951.3237708.p0 Protein 8e-34 41
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_007622.3794472.p0 Protein 1e-33 41
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_002758.1121668.p0 Protein 8e-34 41
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_009641.5332272.p0 Protein 8e-34 41
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein NC_013450.8614421.p0 Protein 8e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein VFG0596 Protein 2e-60 58
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein VFG1389 Protein 1e-37 47
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein VFG1390 Protein 9e-40 44
CFU_2527 YP_004753177.1 putative response regulator for cobalt zinc cadmium resistance transcription regulator protein VFG1386 Protein 5e-33 41